ORFeome > pgm1 – XORFeome 2.0

pgm1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis phosphoglucomutase 1, mRNA (cDNA clone MGC:89497 IMAGE:6992275), complete cds
Gene Symbol: pgm1
Gene ID: 407960
ORF gb_acc: MG134000
ORF ID: 11600

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075554

Library Location

Plate ID: GDExt11015
Well Location: B10

EST Sequences

Clone: MGC:89497 IMAGE:6992275
Trimmed Sequence: ATGGTCAAAATCCAAACAGTCAAAACCAAACCTTATACCGACCAGAAGCCGGGCACCAGCGGCCTCAGGAAGCGGGTCACTGTGTTTCAGACCAACGCTAACTATGCTGAGAATTTCATTCAAAGTATCATCTCCTGCACGGACCCTGCAGAGAGGCAGGATGGGGTCCTGGTGGTGGGAGGAGATGGCAGGTTTTACATGAAGGAAGCGATACAACTCATTATCCAGATCGCTGCTGCTAACGGGATTGGGCGCTTAGTTATTGGACAGAATGGTATTCTCTCTACACCGGCAGTATCCTGCATTATCAGAAAAATTAAAGCCATTGGGGGCATTATTCTGACCGCTAGCCATAATCCAGGGGGCCCAAATGGAGATTTTGGCATCAAGTTTAATACTTCGAATGGAGGTCCAGCACCTGAAGCCATTACTGATAAGATTTTCCAGCTCAGCAAAACCATAGAAGAATATGCTATTTGCCCTGATCTTAAAGTAGATTTGACTACTATTGGAAAACAACAGTTTGACTTGGAGAACAAATTCAAACCATTTACTGTGGAGATTGTAGACTCGGTGGAAGCCTATGCAAACATGCTGAGAAATATATTTGACTTCAGTGCCTTAAAAGAACTACTTTCTGGACAGAACAGACTTAAAATTCGAATTGATGCAATGCATGGAGTTGTTGGCCCTTATGTGAAAAAGATCTTGTGCGAAGAATTGGGAGCTCCTGCCAATTCTGCAGTCAACTGCATACCGCTAGAGGATTTTGGTGGTCACCATCCCGACCCAAATTTGACATATGCTTCTGAGTTAGTGGACACCATGAAGACTGGGGAACACGACTTTGGAGCTGCCTTTGATGGAGATGGGGATCGCAACATGATTCTTGGAAAAAATGGCTTCTTTGTTAACCCTTCTGACTCTGTTGCTGTGATAGCCGCCAACATTTTTAGTATTCCTTACTTCCAACACACCGGTGTTCGTGGCTTTGCAAGGAGTATGCCAACAAGTGGTGCCCTTGACAGAGTGGCAAAAGCTACAAAGATTGCTTTATATGAAACTCCAACTGGGTGGAAATTCTTTGGAAATTTAATGGATGCTAACAAGCTGTCCCTGTGCGGAGAGGAAAGCTTTGGAACTGGCTCTGACCATATTCGAGAAAAGGATGGACTTTGGGCAGTTCTCGCATGGCTATCAATCATTGCCACACGCAAACAGAGTGTGGAGGAAATTCTAAAAGATCACTGGCAGAAGTATGGTCGTAATTTTTTCACACGATATGATTATGAAGAGGTTGATTCTGAAGGAGCTAACAAGATGATGAAAGACCTTGAAACATTGATGTTTGATCGCGCATTCATTGGTCAGCAGCTTTCTGTTGGGGATAAAGTTTATACTGTTGAAAAAGCAGATAACTTTGAGTATAGTGACCCTGTTGATGGAAGTATTTCAAGAAACCAGGGATTAAGGCTTATTTTTGCTGATGGATCTCGAGTCATCTTTAGGCTTAGTGGTACAGGCAGCGCTGGAGCTACCATTAGATTATATATTGACAGCTATGAGAAGGATTTACAGAAAATATATGAAGACCCTCAGGTTATGCTGGGCCCTCTTATTACTATTGCACTTAAGATCTCAAAGTTACAGGAAAGAACAGGTCGCTCAGCTCCTACTGTTATCACATAA
Full Trace Sequence: agtttgtgacattcagctccgggtgctgctcgaactcagcctgcacaatggtcaaaatccaaacagtcaaaaccaaaccttataccgaccagaagccgggcaccagcggcctcaggaagcgggtcactgtgtttcagaccaacgctaactatgctgagaatttcattcaaagtatcatctcctgcacggaccctgcagagaggcaggatggggtcctggtggtgggaggagatggcaggttttacatgaaggaagcgatacaactcattatccagatcgctgctgctaacgggattgggcgcttagttattggacagaatggtattctctctacaccggcagtatcctgcattatcagaaaaattaaagccattgggggcattattctgaccgctagccataatccagggggcccaaatggagattttggcatcaagtttaatacttcgaatggaggtccagcacctgaagccattactgataagattttccagctcagcaaaaccatagaagaatatgctatttgccctgatcttaaagtagatttgactactattggaaaacaacagtttgacttggagaacaaattcaaaccatttactgtggagattgtagactcggtggaagcctatgcaaacatgctgagaaatatatttgacttcagtgccttaaaagaactactttctggacagaacagacttaaaattcgaattgatgcaatgcatggagttgttggcccttatgtgaaaaagatcttgtgcgaagaattgggagctcctgccaattctgcagtcaactgcataccgctagaggattttggtggtcaccatcccgacccaaatttgacatatgcttctgagttagtggacaccatgaagactggggaacacgactttggagctgcctttgatggagatggggatcgcaacatgattcttggaaaaaatggcttctttgttaacccttctgactctgttgctgtgatagccgccaacatttttagtattccttacttccaacacaccggtgttcgtggctttgcaaggagtatgccaacaagtggtgcccttgacagagtggcaaaagctacaaagattgctttatatgaaactccaactgggtggaaattctttggaaatttaatggatgctaacaagctgtccctgtgcggagaggaaagctttggaactggctctgaccatattcgagaaaaggatggactttgggcagttctcgcatggctatcaatcattgccacacgcaaacagagtgtggaggaaattctaaaagatcactggcagaagtatggtcgtaattttttcacacgatatgattatgaagaggttgattctgaaggagctaacaagatgatgaaagaccttgaaacattgatgtttgatcgcgcattcattggtcagcagctttctgttggggataaagtttatactgttgaaaaagcagataactttgagtatagtgaccctgttgatggaagtatttcaagaaaccagggattaaggcttatttttgctgatggatctcgagtcatctttaggcttagtggtacaggcagcgctggagctaccattagattatatattgacagctatgagaaggatttacagaaaatatatgaagaccctcaggttatgctgggccctcttattactattgcacttaagatctcaaagttacaggaaagaacaggtcgctcagctcctactgttatcacataaagtggtataagacatccagtaaacttactggacttccatagcgatccatcccatacctgttccctcagtcttccatctctgtgccgtagtgtgtttattgctattcatgttccagtgacctaagcagataaaagtacagaaattttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVKIQTVKTKPYTDQKPGTSGLRKRVTVFQTNANYAENFIQSIISCTDPAERQDGVLVVGGDGRFYMKEAIQLIIQIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNTSNGGPAPEAITDKIFQLSKTIEEYAICPDLKVDLTTIGKQQFDLENKFKPFTVEIVDSVEAYANMLRNIFDFSALKELLSGQNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCIPLEDFGGHHPDPNLTYASELVDTMKTGEHDFGAAFDGDGDRNMILGKNGFFVNPSDSVAVIAANIFSIPYFQHTGVRGFARSMPTSGALDRVAKATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWLSIIATRKQSVEEILKDHWQKYGRNFFTRYDYEEVDSEGANKMMKDLETLMFDRAFIGQQLSVGDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFADGSRVIFRLSGTGSAGATIRLYIDSYEKDLQKIYEDPQVMLGPLITIALKISKLQERTGRSAPTVIT
Donor tissue: neurula