ORFeome > pla2g12b – XORFeome 2.0

pla2g12b – XORFeome 2.0

General Information

Species: Xenopus tropicalis pla2g12b protein, mRNA (cDNA clone MGC:79728 IMAGE:6982221), complete cds
Gene Symbol: pla2g12b
Gene ID: 493298
ORF gb_acc: MG133724
ORF ID: 11288

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080358

Library Location

Plate ID: GDExt11012
Well Location: H10

EST Sequences

Clone: MGC:79728 IMAGE:6982221
Trimmed Sequence: ATGAAGGGATTTGTCAGGATTGTTGTGCTGTGCTTAGCTTTAAGCATGGGTATTTGCACAGAAGATACAAACCAAAATAACACTGCCAGTCAGGTACCAGAAGAAGACTCGTCAGACTGGGGCATTGGTACAATTAGAGATGGATTTGAGGCAGTTAATGGCTATTTTGACTCCTTTCTGGAACTACTGGGAGGCAGGAATGGTGTGTGCCAGTACAAATGTCGATATGGTAAAGCCCCACTGCCCAGGCCGGACTACAAGTCTCCTGAACCCAATGGCTGCAGTTCTTATTTTCTTGGTCTCAAGATGGATTTAGGTATCCCAGCAATGACAAAATGCTGTAACCAACTGGATATCTGCTATGATACGTGTGGGGCAAACAAATACCGCTGTGATGCCAAGTTTCGCTGGTGTCTGCATGCTATCTGCTCTGACCTCAAAAAAAGTCTGGGATTCGTCTCCAAGGTGGAAGCATGTGAGTCAGTGGCAGACACAGTTTTTAACACCGTTTGGACTTTGGGATGTAAACCCTTCATGAACAGTCAGAGATCATCCTGTATCTGTAATGAAGAGGAACGAGATGAGCTCTAA
Full Trace Sequence: ctggggtgacttacctgcaacatgaagggatttgtcaggattgttgtgctgtgcttagctttaagcatgggtatttgcacagaagatacaaaccaaaataacactgccagtcaggtaccagaagaagactcgtcagactggggcattggtacaattagagatggatttgaggcagttaatggctattttgactcctttctggaactactgggaggcaggaatggtgtgtgccagtacaaatgtcgatatggtaaagccccactgcccaggccggactacaagtctcctgaacccaatggctgcagttcttattttcttggtctcaagatggatttaggtatcccagcaatgacaaaatgctgtaaccaactggatatctgctatgatacgtgtggggcaaacaaataccgctgtgatgccaagtttcgctggtgtctgcatgctatctgctctgacctcaaaaaaagtctgggattcgtctccaaggtggaagcatgtgagtcagtggcagacacagtttttaacaccgtttggactttgggatgtaaacccttcatgaacagtcagagatcatcctgtatctgtaatgaagaggaacgagatgagctctaagagccggtgacctctggacttgtattactacacagtttatcagctgatctgtacagaaagttgcagttctatccactttatttccaacatgaacttacagttctatacagctctgcctccttcattagtctattaactgaacattatgggactgcacatgacaacacctccagactctgaagaccatgggggtactgcagagtttgaaagcaatcattcagttgttccattttgtgaacttttactttaggatggaagactaaagtttctttttctttttaaggcattatacagctcaagatgggcgaatctgagttatacaaagactggagataactgattgttttgagggagggaaaataaatgcaagatagccatagtttgttaaagggaatatatcaaacagaaatgtttagcatccagaaactcacagcatattttttacctcttacttttcatggtaggacacatacagaatattgtcctaattcagatgccccctttataggttataatatattttgcattcagagaaggtgccttctattacctattgtttttgtggattctctattcttataaatacattttgttagaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKGFVRIVVLCLALSMGICTEDTNQNNTASQVPEEDSSDWGIGTIRDGFEAVNGYFDSFLELLGGRNGVCQYKCRYGKAPLPRPDYKSPEPNGCSSYFLGLKMDLGIPAMTKCCNQLDICYDTCGANKYRCDAKFRWCLHAICSDLKKSLGFVSKVEACESVADTVFNTVWTLGCKPFMNSQRSSCICNEEERDEL
Donor tissue: tadpole