ORFeome > plekhj1 – XORFeome 2.0

plekhj1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis pleckstrin homology domain containing, family J member 1, mRNA (cDNA clone MGC:75878 IMAGE:5383075), complete cds
Gene Symbol: plekhj1
Gene ID: 394773
ORF gb_acc: MG132992
ORF ID: 10375

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063351

Library Location

Plate ID: GDExt11004
Well Location: H09

EST Sequences

Clone: MGC:75878 IMAGE:5383075
Trimmed Sequence: ATGCGCTACAATGAGAAGGAGCTGCTGTCCCTCTCTAGGCAGAGAGCAGAGAAAGCGGCAGAGCTGAGTATGAGAGGCCCGAAGAAGGGGAGCGTACTGAAGAAGCGCCTGGTAAAATTGGTTGTGAATTTCCTCTTTTATTTCCGCATAGATGAGGAGGAGCCCATTGGAGCTTTGCTGCTGGAACACTGCAGAGTATCAAAGGAGGATGAAAAAGGATTTTCCATACACTTTATAGATGAGCCAGAAAAAAAGTACATGTTCGAGTGCAGTAGCCAGGAGCAATGTGTAGAGTGGGTAGAAGCTCTAACCAATGCCAGCTATGAGTTTATGAGGAGAAGCCTAATGTTTTATCGCAATGAAATCCTGAAGATGACAGGGAAGGACCCACTTGAGCAGTATGGGATTTCTGGAGAATCACGTTTCCAGTTAGAGAATGCCAGCTTGTGA
Full Trace Sequence: cagctatcagccttattgcgagtttgtgtataatgtggagtctataattgcacatgaatattagtttaaaggtttgaactgtcccctagtgagtttgactccgcttgcttcttttgtgtagtccccggctgttccgcagcctttcttccgcccgcggcgagtcccgggcaatgcagttggctgaagatgcgctacaatgagaaggagctgctgtccctctctaggcagagagcagagaaagcggcagagctgagtatgagaggcccgaagaaggggagcgtactgaagaagcgcctggtaaaattggttgtgaatttcctcttttatttccgcatagatgaggaggagcccattggagctttgctgctggaacactgcagagtatcaaaggaggatgaaaaaggattttccatacactttatagatgagccagaaaaaaagtacatgttcgagtgcagtagccaggagcaatgtgtagagtgggtagaagctctaaccaatgccagctatgagtttatgaggagaagcctaatgttttatcgcaatgaaatcctgaagatgacagggaaggacccacttgagcagtatgggatttctggagaatcacgtttccagttagagaatgccagcttgtgaactaactctggatccagatacgagacctgcagctttgtgcatttctacccatcacacaggcctaggcttactccttccaaggcaactgaaaaatagacttcacgcttgtctctaggaatgcaccatttgtcaggagtttttgcaggcctctcactggttaaatagacttacagacaggccaatgagtgcaacacagaacatagaatctttaaatagtagtaaattgcggaaattgcatatgctggcagggcgtagatatgagaaattcagaatcatgctataagttgtaatggcactgcatccaatgaaatgtgacaggacctccatgattgcaaaattttttattccctagaatacattttctgggagttaaattgaaaatccgctttagcaaatggcacaaagggaataaggacatccatgttacgaaagaaaactcggttttgtttataggagaactttatgctggctgaaggtattctgtatctgactcccacgcaaaagcagcaatgccgtgggtaccaacagtccatggcctaaaacagacctgttttacatgtgactaaatctgttacatagtcggttttatatagaggctctgtttaggaactggggaaaagttccccaatgttggtgaagctgcaactgtatataatggcttttgtgcactgagcaacaaagacggttaaggtaagggatgggcaggtagtggccatgggtgtggcaacagcagtgggaagcagcaagcatttagttacttacagtagatatttgctttgcacttgattgtatacactgccaatttaaatacccataagtacatggtgatcataaaatacatgcaatcacacatagatcctttttaaaggatcttaattacatattgtgtgcctttaattaatttaatgtgaattattaaagaatcattctatgcagcataaaattatctataatttattttgattttgtttttttttaagagaacatgtaaatcttaagtaagtagtgcttttaggaactactagaaataataccaggccaagtcctggggcccatgttgttcttaggctgttggtggcacaccataaaggaataccagaaccaggtatagagaattagaccattatgtggccttctctatctgacagtcatggcactcatgttgtgccagcaatagcgtgttccctagatttagaaagtaggccaagtgagcaaatagcatgatgggctactgaggtatagccgtagctagtaaaatagcctaaaatggccataaacctagcaagtgtctctagttcagtaatctttaatcagcccatctgataaactccttttaaatctatagcattatcagttatatttccctgtgcaacagaagttcacaacttaaaatgaaattattttttacattttattgtgcagtgacaggaaatggccagtaactgtaaaccaaagtggttatgtgtatgcagcacagcagcagtctaaaatccatcaatgggaatctatcaattcttgtttatattgatatgttcacagtgcagctacctcaggttgcagaataaaagcaaatgccctcaacacaagtcagggcaaagcaatcaggaataatgtacactgtgaagcattcattatttgctctggtactggttcttgtagttactaaattgccacttgaattgttgtattttgattcactgtattgaaataaacatgttctaggtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRYNEKELLSLSRQRAEKAAELSMRGPKKGSVLKKRLVKLVVNFLFYFRIDEEEPIGALLLEHCRVSKEDEKGFSIHFIDEPEKKYMFECSSQEQCVEWVEALTNASYEFMRRSLMFYRNEILKMTGKDPLEQYGISGESRFQLENASL
Donor tissue: neurula