ORFeome > polk – XORFeome 2.0

polk – XORFeome 2.0

General Information

Species: Xenopus tropicalis polymerase (DNA directed) kappa, mRNA (cDNA clone MGC:88914 IMAGE:6999308), complete cds
Gene Symbol: polk
Gene ID: 448219
ORF gb_acc: MG134014
ORF ID: 11621

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075278

Library Location

Plate ID: GDExt11016
Well Location: H05

EST Sequences

Clone: MGC:88914 IMAGE:6999308
Trimmed Sequence: ATGGATAACAAGCAAGAAGCAGCGCTTGCTCCCAGCAAGGAAGCCTTTCAGTTTAGGATGGGTCTCAATGACAACAAAGCTGGGATGGAAGGGCTGGATAAGGAAAAAATCAATAAGATCATAATGGATGCAACCAAAGGCTCAAGATTTTATGACAACGAACTGAAGAAAGACCAGCAAGTTAATCAGCGTATTGAAAAGCTGATGCAACAAAAATCTCAGCTGACAGACCAACAAATAAAGAAAGCTCAGATTCAGGTGGATAGACTTGCCTTGGAACTTGAAAGGAACCGTGATTTAAGCCGTATTATTGTCCATGTTGATATGGATGCATTTTATGCAGCTGTAGAAATGCGAGACAGCCCAGAGCTGAAAGACAAGCCAATGGCTGTTGGCTCAAATAGCATGCTGTCTACCTCAAACTATCTTGCAAGGAGGTTTGGTGTAAGAGCTGCAATGCCAGGATTTATTGCCAAGAAGTTGTGTCCCACACTCAAAATTGTTCCACCAAACTTTGATAAATATCGAGCAGTAAGTTCGGAGGTGCGTGAAATTCTAGCCCAGTATGACCCAAATTTTTTACCTATGAGTCTTGATGAAGCTTACCTGGACATCACAGATCATCTGAGTGAGCGCCTGGCTTGGCCAGAGGACAAGAGGACATTTATGATCAGAACTAACAACTCAGGGGGAAACAAACCTCTACCAGGTAAACAAGAACAAGTAGAGTGTACATCACCAGTACTTTTTGAAGACAGCCCTTCCTTTGTAGCAGACCAAAATTTCAGCCAACCAGGGCTAGGCACAACTGAAGAGAACAGAAAACCATCTCTAGAGAATGTGGTCGTGTTTGGAACATCAGTTGAGGAAGCAGTAAAGGAAATGAGGTTTCGCATTGAACAGAAAACAACATTGACTGCAAGTGCGGCATGA
Full Trace Sequence: cgactgaggaagacggaacgttgcttgaatggaggagggaaaaagaaagtgagattattttctgtctattgaggcttgagccatagttggttatgagctacaaatctgcaaaatggataacaagcaagaagcagcgcttgctcccagcaaggaagcctttcagtttaggatgggtctcaatgacaacaaagctgggatggaagggctggataaggaaaaaatcaataagatcataatggatgcaaccaaaggctcaagattttatgacaacgaactgaagaaagaccagcaagttaatcagcgtattgaaaagctgatgcaacaaaaatctcagctgacagaccaacaaataaagaaagctcagattcaggtggatagacttgccttggaacttgaaaggaaccgtgatttaagccgtattattgtccatgttgatatggatgcattttatgcagctgtagaaatgcgagacagcccagagctgaaagacaagccaatggctgttggctcaaatagcatgctgtctacctcaaactatcttgcaaggaggtttggtgtaagagctgcaatgccaggatttattgccaagaagttgtgtcccacactcaaaattgttccaccaaactttgataaatatcgagcagtaagttcggaggtgcgtgaaattctagcccagtatgacccaaattttttacctatgagtcttgatgaagcttacctggacatcacagatcatctgagtgagcgcctggcttggccagaggacaagaggacatttatgatcagaactaacaactcagggggaaacaaacctctaccaggtaaacaagaacaagtagagtgtacatcaccagtactttttgaagacagcccttcctttgtagcagaccaaaatttcagccaaccagggctaggcacaactgaagagaacagaaaaccatctctagagaatgtggtcgtgtttggaacatcagttgaggaagcagtaaaggaaatgaggtttcgcattgaacagaaaacaacattgactgcaagtgcggcatgactaaacatgacttaaagtcagttgatagaagctgatttaagtcacatgaaaaacaggaagtacaaatgcaaagcaagtaattaagcattagttatcagctgtaacattctcaaaaattatcaactttttctacactgtgtaatattattaaacattacatagtttccactcacttaacactgatctgttttaaaataaagatatccctagcttaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDNKQEAALAPSKEAFQFRMGLNDNKAGMEGLDKEKINKIIMDATKGSRFYDNELKKDQQVNQRIEKLMQQKSQLTDQQIKKAQIQVDRLALELERNRDLSRIIVHVDMDAFYAAVEMRDSPELKDKPMAVGSNSMLSTSNYLARRFGVRAAMPGFIAKKLCPTLKIVPPNFDKYRAVSSEVREILAQYDPNFLPMSLDEAYLDITDHLSERLAWPEDKRTFMIRTNNSGGNKPLPGKQEQVECTSPVLFEDSPSFVADQNFSQPGLGTTEENRKPSLENVVVFGTSVEEAVKEMRFRIEQKTTLTASAA
Donor tissue: