ORFeome > polr2f – XORFeome 2.0

polr2f – XORFeome 2.0

General Information

Species: Xenopus tropicalis polymerase (RNA) II (DNA directed) polypeptide F, mRNA (cDNA clone MGC:89914 IMAGE:7029930), complete cds
Gene Symbol: polr2f
Gene ID: 448728
ORF gb_acc: MG133142
ORF ID: 10583

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077687

Library Location

Plate ID: GDExt11006
Well Location: B06

EST Sequences

Clone: MGC:89914 IMAGE:7029930
Trimmed Sequence: ATGTCTGACAACGAGGACAACTTTGATGGAGATGATTTTGATGATGTCGAAGAGGATGAGGGACTTGATGATTTGGACAATGCAGAAGAGGAAGACCAGGAGAATGTGGCAATTCTTCCAGCTGGGGAAGGCCAGCAGGCCAACCAGAAACGCATCACCACCAATTACATGACAAAATATGAGCGGGCCCGTGTGCTGGGAACTCGTGCCCTGCAAATAGCGATGTGTGCCCCTGTCATGGTGGAGCTTGAAGGAGAAACGGACCCCCTACTTATTGCCATGAAGGAACTTAAAGCCAGAAAGATCCCTATAATCATACGCCGTTACCTTCCAGACGGCAGTTATGAGGACTGGGGGGTGGATGAACTCATCATTACCGACTAA
Full Trace Sequence: ggtctgtggccgttcgtgacgccgcaacgaacttatcccagtgtgtgtgtgggaaaagcgagtaggttctgctcggtacctagagccgctgccatgtctgacaacgaggacaactttgatggagatgattttgatgatgtcgaagaggatgagggacttgatgatttggacaatgcagaagaggaagaccaggagaatgtggcaattcttccagctggggaaggccagcaggccaaccagaaacgcatcaccaccaattacatgacaaaatatgagcgggcccgtgtgctgggaactcgtgccctgcaaatagcgatgtgtgcccctgtcatggtggagcttgaaggagaaacggaccccctacttattgccatgaaggaacttaaagccagaaagatccctataatcatacgccgttaccttccagacggcagttatgaggactggggggtggatgaactcatcattaccgactaagacctgtcgtcagtccttgactttccaagcctgaaatctttgacaccagttttattctcttttgtcttgttgtacataattgttttttatgtaaatgctttatttaataaaaacacaaaagaccctcaaaaaaaaaaaaaaaa
Translation: MSDNEDNFDGDDFDDVEEDEGLDDLDNAEEEDQENVAILPAGEGQQANQKRITTNYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Donor tissue: