ORFeome > polr3f – XORFeome 2.0

polr3f – XORFeome 2.0

General Information

Species: Xenopus tropicalis polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa, mRNA (cDNA clone MGC:76106 IMAGE:5308543), complete cds
Gene Symbol: polr3f
Gene ID: 394944
ORF gb_acc: MG132710
ORF ID: 10002

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064209

Library Location

Plate ID: GDExt11001
Well Location: H05

EST Sequences

Clone: MGC:76106 IMAGE:5308543
Trimmed Sequence: ATGTCAGAAGCGAAGGTGAAGCAAGAAGGTGGGGAGGCAGCGGAGATAGAGAACAGGGTTATTGAGCTGTGCCAGCAGTTTCCTCATGGTATCACTGACCAAGTTATTCAAAATGAGATGCCTCACATTGAAGCCAAACAAAGGGCCATGTGCATCAACCGACTGCTGGCAACTGGTCAGCTGGATCTGTTACGAAGTGGTGCAGGACTGCTGTACAGGTTGAAGGATCCACAAACTGCTGGTAAAATGAAGGGTTCAGACAATCAGGAGAAGTTAGTGTATCAGATAATTGAGGATGCTGATAACAAAGGTATATGGAGCCGAGATATAAGGTACAAAAGCAATTTGCCACTGACTGAAATCAACAAAATTTTGAAAAACCTAGAGAGCAAGAAACTTATTAAAGCTGTGAAATCTGTAGCTGCTTCAAAGAAGAAAGTTTACATGTTGTACAATCTGCAGCCAGATCGCTCTGTGACAGGAGGAGCTTGGTACAGTGACCAGGATTTCGAATCTGAGTTTGTGGAGGTGTTAAATCAACAATGTTTTAAATTTCTACAAACCAAGGCTGAAGCAGCAAGGGACAGTAAACAAAACCCCATGATACAGAGGAACAGCTCATTTGCCTCATCCCATGAAGTCTGGAAATACATCTGTGAACTGGGGATTAGCAAGGTGGAATTGTCTATGGAAGATATTGAAACCATCCTGAATACTTTAATATATGATGGGAAAGTAGAGATGACCATAATCGCTGCTAAGGAGGGGACTGTGGGTAGTGTTGATGGACAAATGAAACTGTATAGGGGAGTGAACCCTATCACACAACCTGCAGGTTTAGTGAGAACCCCGTGCGGCCTGTGTCCGGTATTTGACGACTGTCATGAAGGAGGTGAAATTTCCCCATCAAACTGCATTTATATGACAGACTGGCTGGATTTTTAG
Full Trace Sequence: ggaagttgttccgttccaaacgctcccttttgcccgaaagcaaaatggctgccgatactttctgctgatcgagctgcagcgctagtgctacctgaactgggggtgttggggcgacagtcgttaagggggacacgtgggcaaaggatagggactcaaataaacatgtcagaagcgaaggtgaagcaagaaggtggggaggcagcggagatagagaacagggttattgagctgtgccagcagtttcctcatggtatcactgaccaagttattcaaaatgagatgcctcacattgaagccaaacaaagggccatgtgcatcaaccgactgctggcaactggtcagctggatctgttacgaagtggtgcaggactgctgtacaggttgaaggatccacaaactgctggtaaaatgaagggttcagacaatcaggagaagttagtgtatcagataattgaggatgctgataacaaaggtatatggagccgagatataaggtacaaaagcaatttgccactgactgaaatcaacaaaattttgaaaaacctagagagcaagaaacttattaaagctgtgaaatctgtagctgcttcaaagaagaaagtttacatgttgtacaatctgcagccagatcgctctgtgacaggaggagcttggtacagtgaccaggatttcgaatctgagtttgtggaggtgttaaatcaacaatgttttaaatttctacaaaccaaggctgaagcagcaagggacagtaaacaaaaccccatgatacagaggaacagctcatttgcctcatcccatgaagtctggaaatacatctgtgaactggggattagcaaggtggaattgtctatggaagatattgaaaccatcctgaatactttaatatatgatgggaaagtagagatgaccataatcgctgctaaggaggggactgtgggtagtgttgatggacaaatgaaactgtataggggagtgaaccctatcacacaacctgcaggtttagtgagaaccccgtgcggcctgtgtccggtatttgacgactgtcatgaaggaggtgaaatttccccatcaaactgcatttatatgacagactggctggatttttagtgaaaggaggctggcctgttggaccaaaatctaaccagaagagtggtcagtcacaacaaggatacatggctgatagtgaaggaactgctctgttctatgaaatgcagtgtttgactgctgttatatttattttcagatgttttcataattgaaagcagcagtagagaactgttatttttattccatatttgggatgacacctatgaggtataacattttaaagaaataaaaatagttacctcaaaaaaaaaaaaaaaaaaaaaaaaaaaaccaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSEAKVKQEGGEAAEIENRVIELCQQFPHGITDQVIQNEMPHIEAKQRAMCINRLLATGQLDLLRSGAGLLYRLKDPQTAGKMKGSDNQEKLVYQIIEDADNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQTKAEAARDSKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGQMKLYRGVNPITQPAGLVRTPCGLCPVFDDCHEGGEISPSNCIYMTDWLDF
Donor tissue: gastrula