ORFeome > ppih – XORFeome 2.0

ppih – XORFeome 2.0

General Information

Species: Xenopus tropicalis peptidylprolyl isomerase H (cyclophilin H), mRNA (cDNA clone MGC:76244 IMAGE:5378978), complete cds
Gene Symbol: ppih
Gene ID: 394997
ORF gb_acc: MG132784
ORF ID: 10104

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064250

Library Location

Plate ID: GDExt11002
Well Location: G06

EST Sequences

Clone: MGC:76244 IMAGE:5378978
Trimmed Sequence: ATGGCGGTACCGGCTTCCAACGCTAACAATCCCATCGTATTCTTCGATATCAGTATCGGGGGGCAGGAGGTGGGCCGGATGAAGGTGGAACTTTTTGCAGATATTGTACCAAAAACTGCAGAGAACTTCAGGCAATTCTGTACTGGCGAATTTAGGAAAGATGGTGTCCCCATAGGCTATAAAGGAAGCACATTCCATAGGGTAATAAAGGATTTCATGATCCAGGGTGGAGACTTTGTTAACGGGGATGGCACTGGAGTTGCAAGCATATATAGAGGTCCATTTGCAGATGAGAACTTTAAACAAAAACATTCTACACCTGGACTTTTATCCATGGCTAACAGTGGCCCAGGGACGAATGGCTGCCAGTTTTTTATCACATGCTCAAAGTGCGATTGGTTGGATGGAAAACATGTGGTATTTGGTAAAGTAATCGATGGACTTCTTGTGATGAGAAAAATTGAGAATGTACCCACAGGTCCCAACAACAAACCCAAATTGCCGGTTGTGATTGCTCAGTGCGGGGAAATGTAA
Full Trace Sequence: gaaatggcggtaccggcttccaacgctaacaatcccatcgtattcttcgatatcagtatcggggggcaggaggtgggccggatgaaggtggaactttttgcagatattgtaccaaaaactgcagagaacttcaggcaattctgtactggcgaatttaggaaagatggtgtccccataggctataaaggaagcacattccatagggtaataaaggatttcatgatccagggtggagactttgttaacggggatggcactggagttgcaagcatatatagaggtccatttgcagatgagaactttaaacaaaaacattctacacctggacttttatccatggctaacagtggcccagggacgaatggctgccagttttttatcacatgctcaaagtgcgattggttggatggaaaacatgtggtatttggtaaagtaatcgatggacttcttgtgatgagaaaaattgagaatgtacccacaggtcccaacaacaaacccaaattgccggttgtgattgctcagtgcggggaaatgtaagaaaaaagatctaaagatattcatcagtgtgtacttttttggataaatctcatttttgccagtggacctgttattgctgttcctctggggtgtcacagttttgtatggaagaaaaattggacattagtaactagaaaaaagggaaatgatttgctcctttctagttctcaggggatcctgtgcaactgactttaagaccttgttcattctggcaccaaatatgacttctattgatgataccggtatgcaggaagtactagtcctgggaattactaggccaagtaacacttttcatttttgaaagtttttttttttaatttttttaacatactatttctaaataaatgcataaaaattgttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAVPASNANNPIVFFDISIGGQEVGRMKVELFADIVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKQKHSTPGLLSMANSGPGTNGCQFFITCSKCDWLDGKHVVFGKVIDGLLVMRKIENVPTGPNNKPKLPVVIAQCGEM
Donor tissue: tailbud