ORFeome > ppp1r3c – XORFeome 2.0

ppp1r3c – XORFeome 2.0

General Information

Species: Xenopus tropicalis protein phosphatase 1, regulatory (inhibitor) subunit 3C, mRNA (cDNA clone MGC:69369 IMAGE:5309408), complete cds
Gene Symbol: ppp1r3c
Gene ID: 448158
ORF gb_acc: MG133311
ORF ID: 10807

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074693

Library Location

Plate ID: GDExt11007
Well Location: C12

EST Sequences

Clone: MGC:69369 IMAGE:5309408
Trimmed Sequence: ATGCCTGGAGACTTTTCTGTTTGCGTCTGCATCAGCCCCCCACCGCAGCCCCAGTTCCATTGCTCACCCGCTGACTCCCTCCGCCCTTGCTTGGTTCCCACTCGCCGGCCACCCGACCCACGCAAGAAGAATGTGGTCTTTGCTGATGCCCTTGGACTGGCTCTCACTTCTGTGCGGCACTTCACACGTGCATTTTTTGATGAAGAGCCGCTGGTACTTGCACTGGCTTCCCTACGAGCCCTACGCCCACTCTCCAGCCCCACTTACACCCTGGACTTCAGCCCACCAACCCAGGACTATGGGCGCTACAGGGAACAGCTTACACGAAAGTTGGTGTGCTTGGAGCAGTGTGCTGTGCAGGGTGCAGCTGTGGCCGGCACTGTGAGGGTGCGTAACGTTGGCTATGAAAAGCGGGTGACTTTGCGGGTAAGCTATGATGGGTGGTGCAATCACTATGATCTGCCATGCACTTACCTGTTTGACACTCGTAGGGGAGGGGACACGGACTCTTTTTCTTTCCGAATGCCCCTTCCAGTGGGTACAGAGCGAGCAGAGTTCTGTATCTGCTACTGGTGTGCAGGGGAGGAGTACTGGGACAACAATGATGGGAAGAATTACTCCTTGCACAAAGAGGGGAAAGGCAAAGGGTACCTGCAGGGGCCATACTGGTGA
Full Trace Sequence: gtggcaagtaccaaacttggggctttatgtgaagtgtactttatcctgtctgttttccctttcaggcttcccccttctctcccttgaagatgcctggagacttttctgtttgcgtctgcatcagccccccaccgcagccccagttccattgctcacccgctgactccctccgcccttgcttggttcccactcgccggccacccgacccacgcaagaagaatgtggtctttgctgatgcccttggactggctctcacttctgtgcggcacttcacacgtgcattttttgatgaagagccgctggtacttgcactggcttccctacgagccctacgcccactctccagccccacttacaccctggacttcagcccaccaacccaggactatgggcgctacagggaacagcttacacgaaagttggtgtgcttggagcagtgtgctgtgcagggtgcagctgtggccggcactgtgagggtgcgtaacgttggctatgaaaagcgggtgactttgcgggtaagctatgatgggtggtgcaatcactatgatctgccatgcacttacctgtttgacactcgtaggggaggggacacggactctttttctttccgaatgccccttccagtgggtacagagcgagcagagttctgtatctgctactggtgtgcaggggaggagtactgggacaacaatgatgggaagaattactccttgcacaaagaggggaaaggcaaagggtacctgcaggggccatactggtgaacgctgtgggctctgttgaaaagcttgcatctgttaacacttccagtgctggctcgcttgaggtcaggtgcttgtgttatttatcccagtttaaatgaaatggtatttggtacatctgatgctactaacttgcagggtgaccaactactgctcacagccctttggaggaccattccatcatctagaaagaagcctagttgccatggagttggttgcacctgatcatttgtgggagaagtggggcacctactggcctgcacggttggctaccgctgtgcctgaattgcacaagagtagggaaaatgcataatggggattgagaggtagtggcttgtgactataaattgtggcaagtcaagtctgaaggaaccctgtcatggcccaacttgtgttccttctgaagcctttccctgcaggttactcctcttcccctggtgcccatccctagtaactgctctgcctattcagtgggacaaagtaagcaatgattttaagatgtttgcttctccccactttaagctccacttttaccaatgaaccaaataaatataattttttaaatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPGDFSVCVCISPPPQPQFHCSPADSLRPCLVPTRRPPDPRKKNVVFADALGLALTSVRHFTRAFFDEEPLVLALASLRALRPLSSPTYTLDFSPPTQDYGRYREQLTRKLVCLEQCAVQGAAVAGTVRVRNVGYEKRVTLRVSYDGWCNHYDLPCTYLFDTRRGGDTDSFSFRMPLPVGTERAEFCICYWCAGEEYWDNNDGKNYSLHKEGKGKGYLQGPYW
Donor tissue: gastrula