ORFeome > ppp3r1 – XORFeome 2.0

ppp3r1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I), mRNA (cDNA clone MGC:75600 IMAGE:5379222), complete cds
Gene Symbol: ppp3r1
Gene ID: 395037
ORF gb_acc: MG132789
ORF ID: 10112

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064854

Library Location

Plate ID: GDExt11002
Well Location: F04

EST Sequences

Clone: MGC:75600 IMAGE:5379222
Trimmed Sequence: ATGGGAAATGAAGCAAGCTATCCGCTGGAAATGTGCTCACATTTCGATGCTGATGAGATCAAAAGGCTAGGGAAAAGGTTCAAGAAACTGGATTTAGACAACTCTGGTTCCCTGAGTGTGGAGGAGTTCATGTCGTTACCAGAGCTTCAACAGAACCCTCTTGTGCAGCGAGTAATAGACATATTCGACACGGATGGAAACGGAGAAGTAGATTTTAAAGAGTTTATCGAAGGAGTGTCCCAGTTCAGCGTCAAAGGTGATAAGGAGCAGAAACTGAGGTTTGCTTTTCGTATATATGATATGGACAAGGATGGCTACATCTCCAATGGTGAGCTTTTCCAGGTACTGAAGATGATGGTGGGAAACAATCTCAAAGACACTCAGTTACAGCAAATAGTAGACAAAACGATTATCAATGCAGATAAAGATGGGGATGGAAGGATATCCTTTGAAGAATTCTGTGCTGTCGTAGGAGGCTTAGATATCCACAAAAAGATGGTGGTGGATGTGTGA
Full Trace Sequence: ccccctactagaagctgcgggtcagtctacaaccgccctgtgcgcccagcctgagccttgttccgcagcaccgagtggaacagggagagtgccggggattcctgaggccgacacctgagctgtgatagtgaagcgagcgccgctcagccgccaacatgggaaatgaagcaagctatccgctggaaatgtgctcacatttcgatgctgatgagatcaaaaggctagggaaaaggttcaagaaactggatttagacaactctggttccctgagtgtggaggagttcatgtcgttaccagagcttcaacagaaccctcttgtgcagcgagtaatagacatattcgacacggatggaaacggagaagtagattttaaagagtttatcgaaggagtgtcccagttcagcgtcaaaggtgataaggagcagaaactgaggtttgcttttcgtatatatgatatggacaaggatggctacatctccaatggtgagcttttccaggtactgaagatgatggtgggaaacaatctcaaagacactcagttacagcaaatagtagacaaaacgattatcaatgcagataaagatggggatggaaggatatcctttgaagaattctgtgctgtcgtaggaggcttagatatccacaaaaagatggtggtggatgtgtgactgacctgagcagcacccaacacacttgctttcttctccatctctgaagatctgctcaagacgtccagcaatgctctctgtgtattttcaatggaagtatttttctctgtgaagccacattttccaacacgagcctcatgaagccaacttagtgttattgaactttttttgattctctcaataactcagtgtagcactttaaagtctgaaggacagccagatgggaaagagcgtatccctgtggtggagaaaaggaagggagttggctttttatttattttttttttcctccttcatcttttataacaagaaaaatctatatatatagctttctatgtagtcattaggtgggctttaatttaatatacttgagtcaaacaaaactagagtacaagtgccaagcagaatgtacaccatttgttacatgacaagcaaagatcacacagttttatatatggtaggagaatgtatactttgtaactgggtgtccgctcaacgcgttgctttcctgtgaggattgtgtattaactggtacaacgccgtcgttgcttcctgttaatctcatttactttttttttgtaacacaggaaactttgtctgtttaatttatacatgttattctattacaaggcactgtgtgtatcttgctttttggagactttactggcaagagaatcactcagctgcgcacatagcgaccgggcccttatttagtgctctgatacctggcggcagttcactacatttcacccttcttggtgaatgccaaggattattcagattaaactccactatattgatttaaccgtcatgatggtgccatgatggaaacactgactgcttgttggccaatgtgggttcacttattgcccggttgattgatatctaacaattttcggatacgcattactgcaggcagcgtgaccggtaatactgagataatatatatgtatatcagctgagcccttgcctccctgttcttcctggcagttccccacactcttcatgttcatgtctgtcttactactttctatgtgtgatctaaaagtagagagctgataggttcttttcctgaagtgttctcacctctcctatttctgcgctggtacaattggccataacatagatatacaaacaaaaataccaaaaaaataaataaaaaaatccttaaatatataacaaaaaaaaatccaaaaaccctagtttcaaggcatattcttttctttttcttctttggctttggaagtggcacagtggcgccattggccacattaaagtgctctttccaccgcgtaattaagcaacgactgtagctgttccttcgactcagtgctgcacatctaaggctctttctgtgcgagagatcaaggtgcttggtgtccttgcatgacatggagttttgcatgtagatcgattgaaatgatgttcctcttgtttacataatttgcattatatatatatatatatttgagaaaagaaaaaaaaaaaagaaagacgaacctttgccaaactttggtacatgttaatgttcaaccaataaaaagaagaaaccccttttccccccactacatgtaacttccctgcctcggggtccgtgtgtgtgtggtatgctcccagccggtgcttgtctgttccactgtcacttgccatgtactctggggaaagtagtccttttgtgaattttggatttttctttttttcttgttttgtacataagttgtgttatatatatatatatatatatatatacattttagcaaaggctctctgtttctcttgcttgtgcatatcttggctggcgtaaacaaaaaaaaaaaaaaa
Translation: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Donor tissue: tailbud