ORFeome > ppt1 – XORFeome 2.0

ppt1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis palmitoyl-protein thioesterase 1, mRNA (cDNA clone MGC:89627 IMAGE:6995586), complete cds
Gene Symbol: ppt1
Gene ID: 448650
ORF gb_acc: MG134315
ORF ID: 11995

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC076997

Library Location

Plate ID: GDExt11020
Well Location: G02

EST Sequences

Clone: MGC:89627 IMAGE:6995586
Trimmed Sequence: ATGGCAGCGTGTAGGGCTCTTACACTGACAGCTCTGCTACTGACTTTGTGCAATGGGAAGACAGAAGCGGACCCGGTACCTTTAGTTATATGGCACGGAATGGGTGATTCCTGTTGCAATCCCTTCAGTATGGGGGCAGTGAAGAAAATGGTGGAGGAGCAGATTCCAGGCATATATGTTCTTTCACTGGAGATTGGGAACAGCATCCCAGAGGACATGAAAAACAGCTTCTTCCTTAATGTGAACGAACAAGTGGATGGTGTTTGTAAAGAGCTAGCTCAAAATCCTAACCTGAAAAATGGATACAACAGTATGGGATTTTCCCAGGGAGGGCAGTTCTTGAGAGCAGTGGCTCAGAGATGTCCTTCTCCACCCATGAAAAACCTGATTTCTATTGGAGGACAACATCAAGGAGTCTATGGATTTCCACGATGTCCAGGAGAAATTTCCCATATGTGTGACTTGATAAGAAAACTCCTGAATTATGGTGCCTACACTAGAGAAGTACAAGATTATCTGGTTCAAGCTGAATACTGGCATGACCCAATAAATGAAGAGCAATACAGAAACGGCAGTATTTTCCTAGCAGACATCAATCAGGAGAGGCATGTGAATGTGAGTTACAAACAGAATCTTCAGCTGTTGGAAAAGTTTGTGATGGTGAAATTTCTTAACGACACCATGGTAGATCCTCCAGATACAGAATGGTTTGGGTTCTACAGACCAGGACAAAGCAAAGAGACCATCACATTACAGGAGAGCAATTTGTACATGGAGGACCGTTTGGGGCTTAAGGAAATGGAAAAAGCAGGAAGGCTGGTGTTCCTTGGGGTGGAAGGAAATCACCTACAATTCTCAAAAGAGTGGTTTAACAAGAATATCATTCCCTTTCTGCACTGA
Full Trace Sequence: gcgctcgctatcacgtgaccggttatatgtttactgagaatggcagcgtgtagggctcttacactgacagctctgctactgactttgtgcaatgggaagacagaagcggacccggtacctttagttatatggcacggaatgggtgattcctgttgcaatcccttcagtatgggggcagtgaagaaaatggtggaggagcagattccaggcatatatgttctttcactggagattgggaacagcatcccagaggacatgaaaaacagcttcttccttaatgtgaacgaacaagtggatggtgtttgtaaagagctagctcaaaatcctaacctgaaaaatggatacaacagtatgggattttcccagggagggcagttcttgagagcagtggctcagagatgtccttctccacccatgaaaaacctgatttctattggaggacaacatcaaggagtctatggatttccacgatgtccaggagaaatttcccatatgtgtgacttgataagaaaactcctgaattatggtgcctacactagagaagtacaagattatctggttcaagctgaatactggcatgacccaataaatgaagagcaatacagaaacggcagtattttcctagcagacatcaatcaggagaggcatgtgaatgtgagttacaaacagaatcttcagctgttggaaaagtttgtgatggtgaaatttcttaacgacaccatggtagatcctccagatacagaatggtttgggttctacagaccaggacaaagcaaagagaccatcacattacaggagagcaatttgtacatggaggaccgtttggggcttaaggaaatggaaaaagcaggaaggctggtgttccttggggtggaaggaaatcacctacaattctcaaaagagtggtttaacaagaatatcattccctttctgcactgatttttcactattttttaagggcttctgtagcttaattttatgttgcctgtgtatttgtctaatgaaaatattaagagatgaaatgctctccttttgttaatggctcagcttgcagtttaagattgtctaaaggtccccatacatgggccgattgtggctgccgatgtcggtcccttggaccgattctgcaggttttcggtccgtgtaggggcagaaactacggccatacctgacagatatctggcctgaaattggccagatatcgatcaggcaggttaaaagaatgtcagatcggggaccgcatcggctcgttgatgtggcccctgaaccaactgccccattgccgccattataattcgagcgtttggccccagggccaaacgatcgaattagcccacccgtaggtgaccgatatcgcgaggcgacctcgccaagcgagcaaagcttcacgtgtatggggagcttaagcaatcatttccacagaccacttattgtataatccgttaaaagaggcattgctagataaattgacccataatgggactttacattgcagggggaatttctatgctatggcaatttccataacagccacatttgagtttcccataacttgtagagtagcagttccctgtgttttttttccacccttcttcagtaaggcccagcaaggcccagcctaaagatcagtttagctgaaagctggggagaatatctagttgccctcctagatattgctaaaagcccagtttaaatatcaattattgggtgacagagatactataaacaatgtcggaaaaggtattctatagaagaatgggaggtatagtgaccctctgaaacatgtcctttaaatgaaggcactttagtcagggctcttgtaagataaaatgtctttatttactaatgtagatgtaaatttcttttctaacagtagtgccagagaagcatctgtactgtagattgatacattttaactgaccaataaaaaaagcaagatatttttgaaaaactgcactgtttttattgtgatctttaaaatgtatcggcctgtgatattctctgaaataacacctttaaactagtgtttaagccactggttcttttaatggcagctaattaaaggagaaggaaaggtaaaaactaagtaagctttatcagaaaggtctatgtaaatacagccataagcactcacagaaatgctgcactctgtcccctgtcaaaagatttgttgtctctgttttcctgtgccagagacacgcagctctctcccctctcctgctcccccccccccccttaggaatgtgaatctgagccaattagcaggaagcttcctcatagtcttacaaactgagcatgtacacgggttttggtctcagtgcagtagtgaggcattatgggaactttctttacacagctcagcattttttttttcctataaggctactgatcatccacgggagaaatatggggagacttaagggcactattgagagatctgaaggtatgcctgcagcttgagattaactctttattagcctttccttctccttgaaggaagtgatattccagactttacagaaacatatagctatgtcttgctgcttgagtcctggctttgatttcaaatgggcaatatctgcaaggagtttgtatgatttccctgtttctgcatgggcttttcccaaaacaagcaggtgcattggttcctgataaaactgctcttatgtacatgtgatgtgatagggtcaactataagctccactatgcagagactggtgtaaatgatgaacaaaccctataaaagcattctttaataaatgtttgtgctaaataaataaaggataattaaaaaccaaaaaaaaaaaaaaaaaaaaaa
Translation: MAACRALTLTALLLTLCNGKTEADPVPLVIWHGMGDSCCNPFSMGAVKKMVEEQIPGIYVLSLEIGNSIPEDMKNSFFLNVNEQVDGVCKELAQNPNLKNGYNSMGFSQGGQFLRAVAQRCPSPPMKNLISIGGQHQGVYGFPRCPGEISHMCDLIRKLLNYGAYTREVQDYLVQAEYWHDPINEEQYRNGSIFLADINQERHVNVSYKQNLQLLEKFVMVKFLNDTMVDPPDTEWFGFYRPGQSKETITLQESNLYMEDRLGLKEMEKAGRLVFLGVEGNHLQFSKEWFNKNIIPFLH
Donor tissue: neurula