ORFeome > prdx2 – XORFeome 2.0

prdx2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis peroxiredoxin 2, mRNA (cDNA clone MGC:75718 IMAGE:5380854), complete cds
Gene Symbol: prdx2
Gene ID: 394597
ORF gb_acc: MG132968
ORF ID: 10344

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061276

Library Location

Plate ID: GDExt11004
Well Location: A05

EST Sequences

Clone: MGC:75718 IMAGE:5380854
Trimmed Sequence: ATGTCGTGTCCCGTGGGTCCAGGTGTGCGCGCAGTGAAGACTCACATTGGCCAGCCGGCCCCAGCTTTTAAGGCCACTGCTGTGGTCAATGGGGAGTTTAAAGACATCCAGTTGTCAGACTATTTAGGTAAATACGTGGTTTTGTTTTTTTACCCATTGGACTTTACCTTTGTCTGCCCCACGGAGATCATTGCCTTCAGTGACCATGCTGGAGACTTCAGTAAGATCAACTGCCAGCTGATTGCCGTCTCCGTCGATTCCCAGTTCACCCACCTCGCGTGGACCAATGTACCCCGTAAAGAAGGCGGTTTGGGGCCCATTAACATACCCCTGGTGTCTGATCTGACTCATTCTATTGCAAAGGACTATGGTGTCCTGAAGGAAGAGGATGGAGTTGCCTACAGAGGGCTCTTCATTATTGATGGAAAAGGAAACCTTCGCCAGATAACCATTAATGACCTTCCTGTTGGCCGCTCTGTGGAGGAGACCTTGCGCCTGGTGCAGGCATTCCAGTACACGGATCAACATGGCGAGGTATGTCCTGCAGGATGGAAGCCCGGCAGCAGCACCATCAAGCCCAATGTAAAGGACAGCAAGGAGTTCTTCTCTAAAGAATACTGA
Full Trace Sequence: gaccgggaggttttcactgttttcacttggtgtctgtaattcacatcatgtcgtgtcccgtgggtccaggtgtgcgcgcagtgaagactcacattggccagccggccccagcttttaaggccactgctgtggtcaatggggagtttaaagacatccagttgtcagactatttaggtaaatacgtggttttgtttttttacccattggactttacctttgtctgccccacggagatcattgccttcagtgaccatgctggagacttcagtaagatcaactgccagctgattgccgtctccgtcgattcccagttcacccacctcgcgtggaccaatgtaccccgtaaagaaggcggtttggggcccattaacatacccctggtgtctgatctgactcattctattgcaaaggactatggtgtcctgaaggaagaggatggagttgcctacagagggctcttcattattgatggaaaaggaaaccttcgccagataaccattaatgaccttcctgttggccgctctgtggaggagaccttgcgcctggtgcaggcattccagtacacggatcaacatggcgaggtatgtcctgcaggatggaagcccggcagcagcaccatcaagcccaatgtaaaggacagcaaggagttcttctctaaagaatactgaccggctgaagcctactcacaaggtggctcatggatccaatgcactgacctcttcactggccaaacagatgccactcccagtgcttccttctgtagggaagagacagcacttactcctgatcttaattaaaagtcttcttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSCPVGPGVRAVKTHIGQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQLIAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGNLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFFSKEY
Donor tissue: tadpole