ORFeome > prdx4 – XORFeome 2.0

prdx4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis peroxiredoxin 4, mRNA (cDNA clone MGC:79732 IMAGE:6982545), complete cds
Gene Symbol: prdx4
Gene ID: 448526
ORF gb_acc: MG133699
ORF ID: 11255

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076692

Library Location

Plate ID: GDExt11013
Well Location: F01

EST Sequences

Clone: MGC:79732 IMAGE:6982545
Trimmed Sequence: ATGGCTGTGCTGCTCCGGCATTACCTGAGGGGAAGCCCTGTGCTCGGCCTGTGTCTTCTCTTGCTGTCAGCCGCCGCTGTCACCTGTGAGCCCCAGGAGGAGAAGGAGCAGCCTCAAGGCCGGCCTGGCCGCGCTGCCCCGGATGGAGAGTGTCACTTCTACGCAGGGGGACAGGTGTACCCCGGAGAGGCGACCCGTGTGCCGGTGTCCGATCATTCTCTGCACCTCAGCAAAGCAAAAATTTCCAAGCCTGCGCCATACTGGGAAGGAACAGCAGTGATAAATGGAGAGTTCAAAGAGTTGAAACTTACAGATTATAAAGGGAAATATCTGGTGTTCTTTTTTTATCCTCTTGATTTTACATTTGTGTGCCCCACTGAAATCATCGCATTTGGAGACAGAATAGAAGAATTTAGATCCATCAACACCGAAGTTGTAGCCTGCTCTGTGGATTCTCAGTTCACACACTTAGCATGGATAAACACGCCACGCAAACAAGGTGGTCTTGGGCCCATGAAAATTCCTCTGCTCTCTGATTTGACACATCAGATTTCAAAGGATTATGGTGTATATTTAGAAGACCAAGGGCATACACTAAGAGGACTTTTCATTATTGATGACAAAGGAGTCCTTCGTCAGATTACAATGAATGATCTTCCTGTTGGGAGATCTGTAGATGAGACACTACGTCTAGTTCAGGCATTCCAGTATACAGACACACATGGAGAAGTTTGCCCCGCTGGTTGGAAACCTGGGAGTGAAACTATAATTCCTGACCCAGCGGGAAAACTGAAATATTTTCATAAACAACACTGA
Full Trace Sequence: tggatttccatgcacgtctgtcttcccggatctgtgagtgctgcttgccgcttcagcttgtgtatgtgcaatcatggctgtgctgctccggcattacctgaggggaagccctgtgctcggcctgtgtcttctcttgctgtcagccgccgctgtcacctgtgagccccaggaggagaaggagcagcctcaaggccggcctggccgcgctgccccggatggagagtgtcacttctacgcagggggacaggtgtaccccggagaggcgacccgtgtgccggtgtccgatcattctctgcacctcagcaaagcaaaaatttccaagcctgcgccatactgggaaggaacagcagtgataaatggagagttcaaagagttgaaacttacagattataaagggaaatatctggtgttctttttttatcctcttgattttacatttgtgtgccccactgaaatcatcgcatttggagacagaatagaagaatttagatccatcaacaccgaagttgtagcctgctctgtggattctcagttcacacacttagcatggataaacacgccacgcaaacaaggtggtcttgggcccatgaaaattcctctgctctctgatttgacacatcagatttcaaaggattatggtgtatatttagaagaccaagggcatacactaagaggacttttcattattgatgacaaaggagtccttcgtcagattacaatgaatgatcttcctgttgggagatctgtagatgagacactacgtctagttcaggcattccagtatacagacacacatggagaagtttgccccgctggttggaaacctgggagtgaaactataattcctgacccagcgggaaaactgaaatattttcataaacaacactgacatttctgttttttaatataaatccatcggtatttgtttacaccgcttgcaactaataaaattctgtgaattttgttaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAVLLRHYLRGSPVLGLCLLLLSAAAVTCEPQEEKEQPQGRPGRAAPDGECHFYAGGQVYPGEATRVPVSDHSLHLSKAKISKPAPYWEGTAVINGEFKELKLTDYKGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDTHGEVCPAGWKPGSETIIPDPAGKLKYFHKQH
Donor tissue: tadpole