ORFeome > psmb1 – XORFeome 2.0

psmb1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis proteasome (prosome, macropain) subunit, beta type, 1, mRNA (cDNA clone MGC:75736 IMAGE:5381290), complete cds
Gene Symbol: psmb1
Gene ID: 394589
ORF gb_acc:
ORF ID: 10302

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061284

Library Location

Plate ID: GDExt11003
Well Location: G10

EST Sequences

Clone: MGC:75736 IMAGE:5381290
Trimmed Sequence: ATGTTCTCGTCCGAATCCATTTTAAATCGCGAGCTCAGCAAGAGCATGGATTATCACTATACGGGACCTGTGGAGCAGCGATTTAACCCTTACACTTTTAACGGAGGGACTGTGCTGGCTCTTGCAGGTGATGACTTTGCTCTTGTGGCTTCTGACACAAGACTTAGTGAAGGTTATAGTATCCACAGCAGGAACACACCGAAATGCTACAAACTAACAGACAATACAGTTATTGGTTGCACTGGATTCCATGCAGACTGCCTCACACTCACAAAAATTATTGAAGCCAGACTAAAGATGTACAAACATTCAAATAACAAAACGATGACCAGTGGAGCTATAGCTGCCATGTTATCCACCATTCTCTACTCTCGCCGTTTTTTCCCTTACTACGTATACAACATCATTGGAGGCCTTGATGAAGAAGGTAAAGGGGCAGTGTACAGCTTTGATCCAGTTGGCTCATACCAGAGGGATGCATACAAAGCTGGTGGCTCTGCGAGTGCCATGTTGCAGCCTCTTCTTGACAACCAAATTGGATACAAGAACATGCAGAACGTTGAGCAGTTACCTCTGACATTGGAGAAGGCACTGAAGCTCATCAAAGATGTGTTCATATCTGCTGCTGAGAGGGATGTATACACAGGCGATGCACTGCATATAAGCATCGTGACTAAAGATGGCATAAGAGAAGAGTCTGTATCTCTTAGGAAAGATTAA
Full Trace Sequence: ctgggagtgagacagcattggtgattgccggcagtgacagggtctttcactgaagtgtttgaaatgttctcgtccgaatccattttaaatcgcgagctcagcaagagcatggattatcactatacgggacctgtggagcagcgatttaacccttacacttttaacggagggactgtgctggctcttgcaggtgatgactttgctcttgtggcttctgacacaagacttagtgaaggttatagtatccacagcaggaacacaccgaaatgctacaaactaacagacaatacagttattggttgcactggattccatgcagactgcctcacactcacaaaaattattgaagccagactaaagatgtacaaacattcaaataacaaaacgatgaccagtggagctatagctgccatgttatccaccattctctactctcgccgttttttcccttactacgtatacaacatcattggaggccttgatgaagaaggtaaaggggcagtgtacagctttgatccagttggctcataccagagggatgcatacaaagctggtggctctgcgagtgccatgttgcagcctcttcttgacaaccaaattggatacaagaacatgcagaacgttgagcagttacctctgacattggagaaggcactgaagctcatcaaagatgtgttcatatctgctgctgagagggatgtatacacaggcgatgcactgcatataagcatcgtgactaaagatggcataagagaagagtctgtatctcttaggaaagattaattcacatgctgtaggtatcttctgaactcactcagaacattctttgatttctgcaattttgatcttttttatgtttctctaaaaataaaaaaaagaataacttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MFSSESILNRELSKSMDYHYTGPVEQRFNPYTFNGGTVLALAGDDFALVASDTRLSEGYSIHSRNTPKCYKLTDNTVIGCTGFHADCLTLTKIIEARLKMYKHSNNKTMTSGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDAYKAGGSASAMLQPLLDNQIGYKNMQNVEQLPLTLEKALKLIKDVFISAAERDVYTGDALHISIVTKDGIREESVSLRKD
Donor tissue: tadpole