ORFeome > psmd6 – XORFeome 2.0

psmd6 – XORFeome 2.0

General Information

Species: Xenopus tropicalis proteasome (prosome, macropain) 26S subunit, non-ATPase, 6, mRNA (cDNA clone MGC:79563 IMAGE:6978591), complete cds
Gene Symbol: psmd6
Gene ID: 394877
ORF gb_acc: MG133611
ORF ID: 11149

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080335

Library Location

Plate ID: GDExt11011
Well Location: C04

EST Sequences

Clone: MGC:79563 IMAGE:6978591
Trimmed Sequence: ATGCCTCTGGAGAACCTGGAGGAGGAGGGGCTGCCCAAGAACCCGGACCTCCGCATCGCGCAGCTCAAGTTCCTGCTGAGTCTCCCCGAGCACCGCCGGGAGGTGCCGCTCCGCTCCGAGCTCATGGAGGCGGTGACTAGTAACAACATGGCTCCTTATTATGAGGGTCTGTGCAAACACCTGGACTGGACAGTGGACATGGACCTGTTGAATAAAATGAAGAAGGCCAACGAGGAGGAGCTGAAGCGGCTGGACGATGAGCTGGAAGATGCAGAGAAGAATCTGGGGGAGAGTGAGATCCGGGACGCTATGATGGCCAGAGCAGAGTATCTGTGTAGGATTGGCGACAAGGAAGGGGCCCTTACTGCCTTTCGGAAGACCTATGACAAGACTGTGGCCCTTGGGCACCGCTTGGATATTGTGTTTTATCTCCTGAGGATCGGCCTCTTCTATATGGACAATGATCTCATTACACGGAACACCGAGAAAGCCAGAAGTCTTATAGAAGAAGGCGGAGACTGGGACCGGCGGAATCGCTTGAAGGTCTATCAGGGCCTGTACTGCGTGGCTATCAGAGACTTCAAGCAAGCAGCCGACCTCTTCCTCGATACGGTCTCCACATTCACCTCCTATGAGCTGATGGACTACAAGACCTTTGTGACATACACGGTGTACGTCAGTATGATAGCACTCGACCGGCCGGACCTGAGAGAGAAGGTTATTAAAGGGGCAGAGATCCTAGAGGTGCTGCACAGCTTACCCACAGTCCGGCAGTATCTGTTCTCACTGTACGAGTGTCGCTATGGTGTCTTCTTCCAGTCCCTGGCTGCCGTGGAACAGGAGCTTAAGAAGGACTGGCTCTTTGCCTCCCACTACCGTTACTACGTGAGAGAAATGCGGATCCAGGCCTACGGTCAGCTTCTGGAGTCCTACCGCTCGCTAACCCTCGGCTACATGGCCGAGGCATTTGGTGTTGGAGTGGAGTTCATAGACCAGGAGCTCTCCAGGTTTATAGCGGCGGGACGGTTACACTGCAAGATAGACAAAGTCAACGAGATTGTAGAGACCAACAGACCCGACAGCAAGAACTGGCAGTACCAAGAGACGATAAAGAAGGGCGACCTGTTACTGAATAGAGTACAAAAGCTCTCCCGGGTCATCAACATGTAG
Full Trace Sequence: gcggaagtgacgtgcggtgtccatcccttgccggtattgtttctgtgtctccgctgcctgtgccggtgccaagatgcctctggagaacctggaggaggaggggctgcccaagaacccggacctccgcatcgcgcagctcaagttcctgctgagtctccccgagcaccgccgggaggtgccgctccgctccgagctcatggaggcggtgactagtaacaacatggctccttattatgagggtctgtgcaaacacctggactggacagtggacatggacctgttgaataaaatgaagaaggccaacgaggaggagctgaagcggctggacgatgagctggaagatgcagagaagaatctgggggagagtgagatccgggacgctatgatggccagagcagagtatctgtgtaggattggcgacaaggaaggggcccttactgcctttcggaagacctatgacaagactgtggcccttgggcaccgcttggatattgtgttttatctcctgaggatcggcctcttctatatggacaatgatctcattacacggaacaccgagaaagccagaagtcttatagaagaaggcggagactgggaccggcggaatcgcttgaaggtctatcagggcctgtactgcgtggctatcagagacttcaagcaagcagccgacctcttcctcgatacggtctccacattcacctcctatgagctgatggactacaagacctttgtgacatacacggtgtacgtcagtatgatagcactcgaccggccggacctgagagagaaggttattaaaggggcagagatcctagaggtgctgcacagcttacccacagtccggcagtatctgttctcactgtacgagtgtcgctatggtgtcttcttccagtccctggctgccgtggaacaggagcttaagaaggactggctctttgcctcccactaccgttactacgtgagagaaatgcggatccaggcctacggtcagcttctggagtcctaccgctcgctaaccctcggctacatggccgaggcatttggtgttggagtggagttcatagaccaggagctctccaggtttatagcggcgggacggttacactgcaagatagacaaagtcaacgagattgtagagaccaacagacccgacagcaagaactggcagtaccaagagacgataaagaagggcgacctgttactgaatagagtacaaaagctctcccgggtcatcaacatgtagcacctcaggcagcgcttttgttttctttttattattgcgggagaatggattgaggtgtagaaaccttactgagctgtgtataatatcctgtcttattactcagtgttttgtgagatgtgcgaaggcatgtagttaggggtttttacagttttacagaatgtaaacaatccaacgattgcaaaaaaaaaaaaaaaaa
Translation: MPLENLEEEGLPKNPDLRIAQLKFLLSLPEHRREVPLRSELMEAVTSNNMAPYYEGLCKHLDWTVDMDLLNKMKKANEEELKRLDDELEDAEKNLGESEIRDAMMARAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKARSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAADLFLDTVSTFTSYELMDYKTFVTYTVYVSMIALDRPDLREKVIKGAEILEVLHSLPTVRQYLFSLYECRYGVFFQSLAAVEQELKKDWLFASHYRYYVREMRIQAYGQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Donor tissue: tailbud