ORFeome > pvalb – XORFeome 2.0

pvalb – XORFeome 2.0

General Information

Species: Xenopus tropicalis parvalbumin, mRNA (cDNA clone MGC:79722 IMAGE:6981995), complete cds
Gene Symbol: pvalb
Gene ID: 496550
ORF gb_acc: MG134305
ORF ID: 11977

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084183

Library Location

Plate ID: GDExt11019
Well Location: E09

EST Sequences

Clone: MGC:79722 IMAGE:6981995
Trimmed Sequence: ATGGCATTCGGAGGTATCCTGAGTGAGGCTGATGTCAGCGCTGCTCTCCAGAGCGTCCAGGCTGCCGACTCCTTCAACTACAAATCCTTCTTTGCCAAGTCTGGCCTGAGCAGCAAGTCCGCTGATGATGTAAAGAAAGTCTTTGCCATCCTTGACCAGGACAAGAGCGGCTTCATTGAGGAAGATGAATTGAAACTGTTCCTCCAGAACTTCAACTCAGGTGCCAGGGCACTGACTGATGCTGAGACCAAGGCCTTCCTGGCAGCTGGTGACTCTGATGGTGATGGCAAAATTGGAGTTGATGAATTCCAGGCTCTTGTGAAAGCTTAA
Full Trace Sequence: catccctttacttcggtagaagaggactaaaggtttaccatggcattcggaggtatcctgagtgaggctgatgtcagcgctgctctccagagcgtccaggctgccgactccttcaactacaaatccttctttgccaagtctggcctgagcagcaagtccgctgatgatgtaaagaaagtctttgccatccttgaccaggacaagagcggcttcattgaggaagatgaattgaaactgttcctccagaacttcaactcaggtgccagggcactgactgatgctgagaccaaggccttcctggcagctggtgactctgatggtgatggcaaaattggagttgatgaattccaggctcttgtgaaagcttaaattgttaaacctgcaagtcattttcatgtaagctgcagttccacaacatgggcttttcttagttaaattgacacaaatggaacctggttgagcggaacacagacacctcttcagcattttcctccctgcggacaagttttgatttcaccttctgcttgctgaatccaaggcattcaccctgcaaaagaagatattcagtcccatgaccagcaatttacctaagagatgcctacttaacacgctatatttatttattatatttttttatattgatattgcatttactgctgtttatactgttgggacttttgtatatcctccaatgtgcaatccttctttcaatgtcttaatggattgaggcagcagacacaaaaaaacctcagtgctatcaataaatctattttggagtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAFGGILSEADVSAALQSVQAADSFNYKSFFAKSGLSSKSADDVKKVFAILDQDKSGFIEEDELKLFLQNFNSGARALTDAETKAFLAAGDSDGDGKIGVDEFQALVKA
Donor tissue: tadpole