ORFeome > rab35 – XORFeome 2.0

rab35 – XORFeome 2.0

General Information

Species: Xenopus tropicalis RAB35, member RAS oncogene family, mRNA (cDNA clone MGC:76044 IMAGE:5385045), complete cds
Gene Symbol: rab35
Gene ID: 394615
ORF gb_acc: MG133511
ORF ID: 11035

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061434

Library Location

Plate ID: GDExt11010
Well Location: C10

EST Sequences

Clone: MGC:76044 IMAGE:5385045
Trimmed Sequence: ATGGCCCGGGACTACGACCACCTCTTCAAGTTGCTCATCATCGGAGACAGCGGTGTTGGAAAGAGCAGCTTACTTCTAAGATTTGCAGATAACACATTTTCAGGCAGCTATATTACAACAATTGGAGTTGACTTCAAAATCCGGACAGTAGAGATTAATGGAGAGAAGGTGAAACTTCAGATTTGGGACACTGCAGGGCAAGAAAGATTTCGGACCATAACCTCCACGTATTACAGAGGGACCCATGGTGTCATCGTTGTTTACGATGTGACCAGCGCAGAATCATTTGTCAATGTTAAACGATGGTTACATGAAATAAACCAAAATTGTGATGATGTATGTAGAATATTAGTGGGTAATAAGAATGATGACCCTGAACGGAAAGTGGTGGAGACAGAGGATGCCTATAAGTTTGCTGCGCAGATGGATATCCAACTGTTTGAGACTAGCGCCAAAGAGAATTTAAATGTTGAAGAGATGTTTAACTGCATTACTGAGCTGGTCTTGCGAGCAAAGAAAGACAACCTAGCAAAACAGCAGCAGCAGCAACAGAATGATGTGGTGAAACTAAGCAAAAACAGTAAACGGAAGAAGCGATGCTGCTAG
Full Trace Sequence: cgggaagcggattcggtcggaatagagcgcgcggatcccgggaccgggcctcacatttgcacaggtcgccaccatggcccgggactacgaccacctcttcaagttgctcatcatcggagacagcggtgttggaaagagcagcttacttctaagatttgcagataacacattttcaggcagctatattacaacaattggagttgacttcaaaatccggacagtagagattaatggagagaaggtgaaacttcagatttgggacactgcagggcaagaaagatttcggaccataacctccacgtattacagagggacccatggtgtcatcgttgtttacgatgtgaccagcgcagaatcatttgtcaatgttaaacgatggttacatgaaataaaccaaaattgtgatgatgtatgtagaatattagtgggtaataagaatgatgaccctgaacggaaagtggtggagacagaggatgcctataagtttgctgcgcagatggatatccaactgtttgagactagcgccaaagagaatttaaatgttgaagagatgtttaactgcattactgagctggtcttgcgagcaaagaaagacaacctagcaaaacagcagcagcagcaacagaatgatgtggtgaaactaagcaaaaacagtaaacggaagaagcgatgctgctaggtgcaggcacagcacagagaggctgctctcaatccgaacattcgctcttggaacaaagagtagtagtgccatgggcagtgcccagctttcaggggttggggcatattcttagttatgtgctgtttatttaagaattttctccaagttttctattgaggcgctggcaccctttttattgctgtgccaagaaggtgttgtggattcttgtcatcccctgccacccctgctcttccagagcgtctgctaggaaaggacggatgcagtgcctaccctatggactgattaacaagagtctgtacatactgtatattgtgttaaccagcctcactcccccccctgctgctttcgcttacaccttatcgccagtctgtcatgtgtgaatatgaactggtcactttttaaagtttttagaacagatggcgtcttaactatgccctgcccctggtttctttactacctgatatggtaagatggaccaggccttgctgttaattcacttctctgccccctttcctcaccatatttaaaaacatgctaaaaatcaaccatgcagctattccattgtccagaccaggatttacgacttccagcgtaattctgtttttaaacaacgggtgggtggatcccatcaatatttccacctattcaagaaccatgtgaatttaagtaaaaaattatggaaaaaatctgccaaatttttgtaccatcttgttcataaataggaacgaactaataaaatgtgaacctccgggtcctgatttaaagacaaaaagaaaaaaaaaaaaaaa
Translation: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAAQMDIQLFETSAKENLNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLSKNSKRKKRCC
Donor tissue: gastrula