ORFeome > rab5b – XORFeome 2.0

rab5b – XORFeome 2.0

General Information

Species: Xenopus tropicalis RAB5B, member RAS oncogene family, mRNA (cDNA clone MGC:88997 IMAGE:7004179), complete cds
Gene Symbol: rab5b
Gene ID: 448258
ORF gb_acc: MG134005
ORF ID: 11605

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075323

Library Location

Plate ID: GDExt11016
Well Location: C02

EST Sequences

Clone: MGC:88997 IMAGE:7004179
Trimmed Sequence: ATGGCCGGTAGAGGAGCTGCAAGGCCAAACGGTCAGTCGCAAGCCAGTAAAATATGCCAATTCAAATTGGTGCTGCTGGGTGAATCGGCAGTAGGAAAGTCGAGCCTGGTATTGCGTTTCGTGAAGGGGCAATTTCATGAGTTTCAGGAAAGTACCATTGGTGCGGCATTTCTCACACAGTCTGTCTGCCTGGATGACACAACTGTAAAATTTGAAATCTGGGATACAGCAGGACAAGAGCGATACCACAGCTTGGCACCCATGTATTACCGGGGAGCACAGGCTGCCATTGTGGTATATGATATCACAAACCAGGAAACATTTGCCAGAGCCAAGACATGGGTAAAAGAGTTACAGAGGCAAGCCAGTCCTAACATTGTGATAGCTTTGTCAGGGAACAAGGCTGACCTCACTAGTAAACGGATGGTGGAGTATGAAGAAGCCCAAGCATATGCAGATGACAACAGCCTGCTCTTTATGGAAACCTCTGCCAAAACCGCTATGAACGTCAATGATCTGTTTCTTGCAATAGCTAAGAAGCTGCCAAAAACCGAACCTCAGAACACTAGTGGTGCACCTGGCAGGAGCAGGGGTGTGGATCTTCATGAGCAGACCCAGCAGAACAAGAGCCAGTGCTGCAGCAACTGA
Full Trace Sequence: gcagttaacagttttgcgggaggtgtaagtaacgatccgggactgcgggctgttagggaaatctggactgttgggctgtataaggaaaagccagactgctgggcagtatgaacgctgtataggggaaagaacatacaggcaccctagcaaccgccctcccgaagtctgcagctcactgacagcaggggtcccggtaatccaatctacttttgcttggatctgctgcctgtcctccacctgcccagtgattgtccagatccttcctccatcctctggagcccttcctctttttactttctaggacatggccggtagaggagctgcaaggccaaacggtcagtcgcaagccagtaaaatatgccaattcaaattggtgctgctgggtgaatcggcagtaggaaagtcgagcctggtattgcgtttcgtgaaggggcaatttcatgagtttcaggaaagtaccattggtgcggcatttctcacacagtctgtctgcctggatgacacaactgtaaaatttgaaatctgggatacagcaggacaagagcgataccacagcttggcacccatgtattaccggggagcacaggctgccattgtggtatatgatatcacaaaccaggaaacatttgccagagccaagacatgggtaaaagagttacagaggcaagccagtcctaacattgtgatagctttgtcagggaacaaggctgacctcactagtaaacggatggtggagtatgaagaagcccaagcatatgcagatgacaacagcctgctctttatggaaacctctgccaaaaccgctatgaacgtcaatgatctgtttcttgcaatagctaagaagctgccaaaaaccgaacctcagaacactagtggtgcacctggcaggagcaggggtgtggatcttcatgagcagacccagcagaacaagagccagtgctgcagcaactgatagattaaagagcaggggaaccaagataagattaaaacctctattcctacacctgcccttatatgctccagaattactactaagctccttttcagcacctcactcttgccaggacataacacttctgcactcttgctttcctactcaccatcggataacagcacaaaacaagccaatgtgcttttgaaacctaaccaaccacctcccacaccaccaccgccctctgagagctccctgctaactgcactattgggtatattgctttgtttaaaataaaaagaaaccgcttccaacaaaacacacagactactcttggttaagaagcgaaggatcatctgttgactacacctcctgaaaagagcaaaaaggagaaaaatacaaagcagcaaacacttactactcacttactacagatgcatatagtgactttggtattgatctttggtttgatttaagcctttgtttttttttctaccattttttctgccttttctccatttctccttattttgcaggactaagctattttacttgtccatcagatcttcagtcataagcggagcttcatgctttgagatcagaagatacaaagtgtaaacatatagatatatactttttccttttttttgctgcagagctacccagctaccaatgtctgttatttgtgtgtctggactttgactgctggtaaatcatccattgactatgaacttttactgctttggccgaaaaacatcaagagcaattgaataaatattgtgaattttgtttgaagaattttaaaggggtggttcatatctgcgttaacttttagtgttctaaagaatggctaattctaagagacttttcaatttaccttcatttttttcatttttaaagtttttgagttttgtcttcttctcctggctctttccagctttaaaatgggggtcactgaccccaacatctaaaaaagacaaatgctctataagactatatttttattactcatctttggattcaggctctatcctatacatgttccagtctctcatacaaatcagtgcctggttgctagggtaatttggacgctatcaaacagataactgctgaatatcaaattggagagctactcaagaaaatgagaaataactcaaaccacaaattataaaaaatgaaacccaattgcaaattgtctcagaatatcactctacagaatgctaaaagttaaggaaaacaacccctttaaatgaaccgttgcctgtgaggtttctgatcatgttaaacagtggagaaagtgagccacttggcactgaaggggaatttgttgtgagcacagtgctttccaggctcctgaccctttgtcactaataagccaatagttacctatttgttctgtaaagcacatgagtaggtttgtgggaccttttgaaaacaaaatctttgatcagaaacatgcagtatattaatgcttctttgtacactccaaacatgggtctccccagtgtaaatggcatgtgtatttacagtgacagtaaaataaaagcaacactagattcttctcatacaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAGRGAARPNGQSQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPNIVIALSGNKADLTSKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKTEPQNTSGAPGRSRGVDLHEQTQQNKSQCCSN
Donor tissue: