ORFeome > rbbp7 – XORFeome 2.0

rbbp7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis retinoblastoma binding protein 7, mRNA (cDNA clone MGC:76124 IMAGE:5309101), complete cds
Gene Symbol: rbbp7
Gene ID: 394900
ORF gb_acc: MG132714
ORF ID: 10008

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064219

Library Location

Plate ID: GDExt11001
Well Location: E11

EST Sequences

Clone: MGC:76124 IMAGE:5309101
Trimmed Sequence: ATGGCGAATAAAGAGATGTTTGAAGATACAGTGGAAGAACGTGTCATCAATGAAGAGTATAAGATATGGAAAAAAAATACCCCATTTCTGTATGACCTGGTTATGACCCATGCACTTGAATGGCCAAGTCTAACAGTTCAGTGGCTCCCGGATGTGACTAGACCAGAAGGAAAGGACTATGCGCTGCACTGGTTGGTCTTAGGTACTCACACTTCAGATGAACAAAATCACCTTGTAGTGGCTCGTGTCCAGATTCCCAATGACGATGCCCAGTTTGATGCCTCACATTATGATAGTGAGAAAGGAGAGTTTGGTGGCTTTGGTTCTGTTAGTGGCAAAATTGAAACAGAAATTAAAATTAACCATGAAGGAGAGGTGAACCGCGCTCGTTACATGCCCCAAAATCCATGTATCATTGCAACTAAAACTCCTTCTGCAGATGTGCTGGTTTTTGATTATACCAAACATCCTTCTAAACCTGACCCTAGTGGAGATTGCAGTCCTGATCTCAGACTTAGAGGACACCAGAAGGAAGGCTATGGCCTATCTTGGAACTCAAACCTTAGTGGACACCTTCTCAGTGCATCAGATGATCATACTGTTTGTTTATGGGACATAAGCGCAGGACCAAAAGAAGGCAAGGTAGTTGATGCAAAAGCCATCTTTACTGGCCATTCTGCAGTAGTAGAGGATGTGGCGTGGCACCTTCTGCACGAATCCTTATTTGGCTCTGTTGCAGATGATCAGAAGCTTATGATCTGGGACACAAGGTCAAATACCACTTCTAAACCCAGCCATTCAGTGGATGCGCATACTGCTGAGGTCAATTGCTTGTCCTTCAATCCATACAGCGAGTTCATTTTGGCCACAGGTTCTGCGGATAAGACTGTAGCTCTTTGGGATCTCAGGAATTTAAAGCTGAAGCTCCATTCCTTCGAATCTCATAAGGATGAAATTTTCCAGGTTCACTGGTCTCCTCATAATGAAACTATTTTAGCTTCCAGCGGTACAGATCGAAGACTTAATGTCTGGGATTTAAGTAAAATTGGAGAAGAGCAGTCAGCAGAAGATGCTGAGGATGGACCTCCTGAGCTTTTGTTTATACATGGAGGGCACACAGCAAAAATCTCTGACTTCAGCTGGAACCCAAATGAACCATGGGTGATATGTTCAGTGTCTGAAGATAACATCATGCAAATATGGCAGATGGCTGAAAATATTTACAATGATGAAGAACCTGACATACCAGCTTCTGAGCTAGAAGCTCAAGGATCATAG
Full Trace Sequence: cgggaagctgcagcaggaccgcacaagcgcggaacactgggtttttagtcaccgcgaggccggcggcccttgcatctgcacaggagtagagaagatggcgaataaagagatgtttgaagatacagtggaagaacgtgtcatcaatgaagagtataagatatggaaaaaaaataccccatttctgtatgacctggttatgacccatgcacttgaatggccaagtctaacagttcagtggctcccggatgtgactagaccagaaggaaaggactatgcgctgcactggttggtcttaggtactcacacttcagatgaacaaaatcaccttgtagtggctcgtgtccagattcccaatgacgatgcccagtttgatgcctcacattatgatagtgagaaaggagagtttggtggctttggttctgttagtggcaaaattgaaacagaaattaaaattaaccatgaaggagaggtgaaccgcgctcgttacatgccccaaaatccatgtatcattgcaactaaaactccttctgcagatgtgctggtttttgattataccaaacatccttctaaacctgaccctagtggagattgcagtcctgatctcagacttagaggacaccagaaggaaggctatggcctatcttggaactcaaaccttagtggacaccttctcagtgcatcagatgatcatactgtttgtttatgggacataagcgcaggaccaaaagaaggcaaggtagttgatgcaaaagccatctttactggccattctgcagtagtagaggatgtggcgtggcaccttctgcacgaatccttatttggctctgttgcagatgatcagaagcttatgatctgggacacaaggtcaaataccacttctaaacccagccattcagtggatgcgcatactgctgaggtcaattgcttgtccttcaatccatacagcgagttcattttggccacaggttctgcggataagactgtagctctttgggatctcaggaatttaaagctgaagctccattccttcgaatctcataaggatgaaattttccaggttcactggtctcctcataatgaaactattttagcttccagcggtacagatcgaagacttaatgtctgggatttaagtaaaattggagaagagcagtcagcagaagatgctgaggatggacctcctgagcttttgtttatacatggagggcacacagcaaaaatctctgacttcagctggaacccaaatgaaccatgggtgatatgttcagtgtctgaagataacatcatgcaaatatggcagatggctgaaaatatttacaatgatgaagaacctgacataccagcttctgagctagaagctcaaggatcatagatctttttcctttttcttattcacactcactattgcagatgctgccacatttgtgacgtggttaatgtttgtgtaagttaatttgcaattctgagtacatgtattgacattttctttgtaaattgtattgtaatattcttgctctttgtattggatacctgggggactcgctgaagcggctgatggaataaaaaaaaaaaattaataacaaaaaaaaaaaaaaaaaaaaaaa
Translation: MANKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATKTPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAGPKEGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEEPDIPASELEAQGS
Donor tissue: gastrula