ORFeome > rbm18 – XORFeome 2.0

rbm18 – XORFeome 2.0

General Information

Species: Xenopus tropicalis RNA binding motif protein 18, mRNA (cDNA clone MGC:79687 IMAGE:6980759), complete cds
Gene Symbol: rbm18
Gene ID: 496464
ORF gb_acc: MG134290
ORF ID: 11962

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084179

Library Location

Plate ID: GDExt11019
Well Location: E06

EST Sequences

Clone: MGC:79687 IMAGE:6980759
Trimmed Sequence: ATGGAAGACAACCCTAAGATGTTGCCTCTTGAAAATGCAGCAATTCTGTCTGAGGGCTCTCTACAAGATGGTCATCGCTTGTGGATTGGCAATGTGGATCCTAAAATAACAGAGTATCACCTTTTAAAACTGCTTCAAAAATTTGGAAAAGTAAAGCAATTTGATTTTCTGTTCCACAAATCCGGACCATTAGAAGGACAGCCCAGAGGATACTGTTTTGTAAACTTTGAGACAAAAGCAGAAGCAGAGAGAGCAATTCATTGTCTCAATGGGAAAATGGCCCTTTCCAAGAAACTTGTGAGATATGATAACTATAAAAGTGAAAAGGTTTTACCAATCAGTCTTGAGCCATCTTCAAGCACAGAACCAACTCAATCTACCCTAAGTGTCAGTGCTAAGATTAAAGCCATTGAAGCTAAACTGAAAATGATGGCAGAAAATCCAGATCCATTGCTCCCCGGGCAGTCGACCTATTCCTACTTCAAGTCGAATGAAAAGAGAAAAAACGCGCCATACCCGAAATCTTCACAGAAATCCAAGAGATGA
Full Trace Sequence: ctgggagagaggaggctagcgagagctgtatgacattgtagagctctattcgttttgtagcagagctgtttgtcaatggaagacaaccctaagatgttgcctcttgaaaatgcagcaattctgtctgagggctctctacaagatggtcatcgcttgtggattggcaatgtggatcctaaaataacagagtatcaccttttaaaactgcttcaaaaatttggaaaagtaaagcaatttgattttctgttccacaaatccggaccattagaaggacagcccagaggatactgttttgtaaactttgagacaaaagcagaagcagagagagcaattcattgtctcaatgggaaaatggccctttccaagaaacttgtgagatatgataactataaaagtgaaaaggttttaccaatcagtcttgagccatcttcaagcacagaaccaactcaatctaccctaagtgtcagtgctaagattaaagccattgaagctaaactgaaaatgatggcagaaaatccagatccattgctccccgggcagtcgacctattcctacttcaagtcgaatgaaaagagaaaaaacgcgccatacccgaaatcttcacagaaatccaagagatgatattctgctacaagccactacaattttgtcacaggcagcaactgttgcttcagtactaaacaaacctcatgcgactcttgctgatttctaaagactttgtgataatgtgtgaaaaacactcacgcatattccaattttattttttaatttatttaagatttcaaatttcttgactgtcgttttgttacgcaagtatttgtacttgagtcctctattcctatactggagaaagtttttaagcacatctggaaagcatacatttagcaggattgaacaaatgtggattatgaaatgtaagaatgcctcagtcagagattctatgtcaagtttttgactgcatgcttgacattagtcttctgctaagaatgcatgaaacttggacccattctcattaccgccattagcaatcttctctgttttaagtctccagtctccagtctccttccagttcttccccaagtacacagataagctctggttaagcctgttctactgagaaccaggttgcactgacctctgtgggcactgtaaagaagtttgatggaactgctggcacggagaaggaatttacttacgcagggaaagtttcctagtggagttaacaggctcagtgtatatgcccaagtgaaagatgttggactgtagaattggcatattacattcataagtatatgaagaatacaagcagtgctttcagcctgtaacaacctgtttgcttttttttaagaaactacaatatgtttgcttttgtctacttgtaatatggtgcggcattgtcttgaactactgtttgaggaccagcatttgggacagttccaggagcatccagaacagcaaatatgcattcatccctgacctatgggaacccatctttcaagagactataagactcgagtgataataaaacaaaattgtggcaagaaagaacagtgattattattgcagggggactcagaggtgtttataccctcctgttttttgatcggatatgggaatattgctgcctatcgcttccgtttgttattatacatgggaagacttgtgactgagaatatgttactaaaatatattttgttttgttttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEDNPKMLPLENAAILSEGSLQDGHRLWIGNVDPKITEYHLLKLLQKFGKVKQFDFLFHKSGPLEGQPRGYCFVNFETKAEAERAIHCLNGKMALSKKLVRYDNYKSEKVLPISLEPSSSTEPTQSTLSVSAKIKAIEAKLKMMAENPDPLLPGQSTYSYFKSNEKRKNAPYPKSSQKSKR
Donor tissue: tailbud