ORFeome > rbm24 – XORFeome 2.0

rbm24 – XORFeome 2.0

General Information

Species: Xenopus tropicalis RNA binding motif protein 24, mRNA (cDNA clone MGC:75808 IMAGE:5382283), complete cds
Gene Symbol: rbm24
Gene ID: 394612
ORF gb_acc: MG132917
ORF ID: 10283

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061322

Library Location

Plate ID: GDExt11004
Well Location: E03

EST Sequences

Clone: MGC:75808 IMAGE:5382283
Trimmed Sequence: ATGCACACCACCCAGAAGGACACTACCTACACCAAGATCTTCGTCGGGGGGCTGCCCTATCACACCACGGACTCCAGCCTCAGGAAGTACTTTGAGGTGTTTGGCGACATAGAGGAGGCGGTGGTGATCACGGACAGACAGACCGGCAAGTCTCGGGGCTATGGCTTTGTCACGATGGCAGACAGAGCTGCAGCTGAAAGAGCTTGCAAAGACCCCAATCCAATTATAGATGGCAGGAAAGCAAATGTGAATCTTGCATACCTGGGAGCAAAACCACGGATAATGCAGCCAGGTTTTGCATTTGGTGTTCAGCAGATTCACCCAGCACTTATACAAAGACCTTTTGGGATCCCTGCACATTATGTTTACCCACATGCTTTCGTGCAGCCAGGAGTTGTAATTCCACATGTCCAGCAAGCCGCTGCTGCATCCACAAGCCCCTACATTGACTACACCAGTGCTGCCTATGCACAGTACTCTGCTGCTGCCGCCGCCGCTGCTGCGTATGATCAGTACCCGTATGCTGCCTCTCCAGCTACAACGGGATATGTCACCACTGCCGGTTATGGCTATGCAGTCCCACAACCACTTACAGCTGCAGCACCAGGAACTGCTGCTGCAGCGGCTGCTGCCTTTGGTCAATACCAACCACAACAACTGCAAGCTGACCGCATGCAGTAG
Full Trace Sequence: gtgtgtggctggtctcccgagacttccccaagcgcgccggctctgacagcgaccaggagtgtagggctttccacttgcttccctcccgctccccatatctacctcagagagagccgcgcatcccacaccctcggggctcaagctaaagaaagggaattggcacctgctgctgctgctgctgtgagcgctccctgaaacagagaggaccgggggcaaaatgcacaccacccagaaggacactacctacaccaagatcttcgtcggggggctgccctatcacaccacggactccagcctcaggaagtactttgaggtgtttggcgacatagaggaggcggtggtgatcacggacagacagaccggcaagtctcggggctatggctttgtcacgatggcagacagagctgcagctgaaagagcttgcaaagaccccaatccaattatagatggcaggaaagcaaatgtgaatcttgcatacctgggagcaaaaccacggataatgcagccaggttttgcatttggtgttcagcagattcacccagcacttatacaaagaccttttgggatccctgcacattatgtttacccacatgctttcgtgcagccaggagttgtaattccacatgtccagcaagccgctgctgcatccacaagcccctacattgactacaccagtgctgcctatgcacagtactctgctgctgccgccgccgctgctgcgtatgatcagtacccgtatgctgcctctccagctacaacgggatatgtcaccactgccggttatggctatgcagtcccacaaccacttacagctgcagcaccaggaactgctgctgcagcggctgctgcctttggtcaataccaaccacaacaactgcaagctgaccgcatgcagtagcactttgacttttgagcagatcactcactctcttgttttcagccatcagtagatgatactgtgtacatataggcaaatggctttaactaaagtagggggaaaagaaacaccttaaccaagtttttttggagagcaaagtattccagcttctctatgcagtaaatattcaagaacagtgtacatgtttgttatcaaggacaaccgaataaacaacttgaaaagattttcaatttggcacacagagactttttttatatcagggaaaggaactgcctttaactaatctgggaagatcttttctgtaaatagtaacattttttttttttctatttccacaaagcctctaaaccagggaaatatcagcaatatgtagcctgtacagagtaaaacatgggcagcagaaacgttcacatcttctccatgcatttttttttttttttttctcttctaaagtgttcatggtctcaaaatgggcatggaagcacatggcctgctggtcacaggatggacaggcaccaaagcaatcttctcgtctatcctctacatgagtggaactatatggagcaagtgatgtggaattaacatgtgcaacagctgtacagacaatcaataatgcagaccgttctggagagaacacatcacttgtgcttatttgatgagcttgtcacattctaatccctctccccatcctgtttcgcttttgggaaactttaaactgctggtgtcagcttttctgattctaaaacgggatcagtcctttactaaaacagccttctattttattactcctattcatagtttgtagactacaaaaaaggaacttgataagtttaaccctttaaagaactgggggggtttttttgttgttttttttgccccttcccttttggttaaaaaaagtacaactttgcattgcagttttaaagggttaattcagatggtttgtactgtgccttaactgtaatgttattgaaagaaacatatatttattttgaaagttttactacagtgtgctctgaagaagggacctttagatgcaacactaaaatgatgtattcatctcatggtataagttatttaagtaagtttagatgtagtaaattaaaatattaatctattcaactgaaatgttgacctggatttatttaaattctgtatgtgcactgtataatgataaccctaatttaacatttagaattttaccttaatttagtcaattcctgctttattttttctttctttctccctcctttctggcgacctctcttgcgcagtaacactaaacatttcatttgtacttaggggtaacttctgatttttccttattagtaaagtgctgctttacacaatgaacttgtaaaaactgcaatacttgcaatttttattcttgaacttaggtttaaatattttacactgtaatgggtttttatacttgaaaaaaagaatcatacaagggaagaaaacagacagcatttttatggacattgtctaaatgtcactggatttatttttaagtattccaaaaactagccagtgttatgtaacttgtagacaaggaatccatgcttatttattcattacatattgctttataacattaaatctattcacttgtattaaatataataaaacattaaaaaaaaaaaaaaaaaaaa
Translation: MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQIHPALIQRPFGIPAHYVYPHAFVQPGVVIPHVQQAAAASTSPYIDYTSAAYAQYSAAAAAAAAYDQYPYAASPATTGYVTTAGYGYAVPQPLTAAAPGTAAAAAAAFGQYQPQQLQADRMQ
Donor tissue: neurula