ORFeome > rem1 – XORFeome 2.0

rem1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis RAS (RAD and GEM)-like GTP-binding 1, mRNA (cDNA clone MGC:121535 IMAGE:7617051), complete cds
Gene Symbol: rem1
Gene ID: 100124825
ORF gb_acc: MG136205
ORF ID: 14554

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC135453

Library Location

Plate ID: GDExt11043
Well Location: E08

EST Sequences

Clone: MGC:121535 IMAGE:7617051
Trimmed Sequence: ATGTGCGCCTCACGAGCTCCCCTGAGGAGGCGGGCCAGCACCCCATTACCTTGTGCCCATCAGAACCGCCAGCGAGGAGCAACTCCCATAAGGAAGCTATACTCACCTTCTAAAGCTGCTGGGAGTGCCCACTGCAGTGGCTCCTTAGACTCAGGGGTCTCGGATGGGAGAAACGAGGCCCATTTAAGAGTGGTACTACTTGGAGACCCAGGGGTTGGAAAGTCCAGTCTTGTGGCCATCTTTCGAAGGGAGCAGGATAGAGAAGCAGCAGAACAGCAGCTAGAAGTGTTTGATTGCACCCTGATGGTGGACGGCAAGGAGACCACCCTGCTGGTCATGGATACGGATGAACGCAACATGAAGAAAGCCATCGAGAGCAGTGATAGCCCCATGCGCCTCGGCAACGCCTACATCATCGTGTACTCAGTCACTGATAGGGCCAGCTTTGAGAGCGCGTCAGAACTTCGAATACAGCTTAGAAGAACTCGTCAGGCTGAAAATATCCCAATAATCCTTGTTGGCAACAAGACGGACCTTGTCCGCAGCAGAGAAGTTTCTGTGGAAGAAGGTCGAGCGTGTGCTGTGGTGTTCGACTGTAAGTTCATCGAGACCTCTGCTGTCCTACAGCACAATGTCCAAGAATTGTTTGAGGGGATGGTGCGCCAGATCAGATTGCGTAGAGAGGGGGCAGACACAGCTGAGGGTTTTCGCATGCAGAGCCAACGCAAGGAGAGTCTGACCAAGAGGGCACGAAGGTTCTTGGACCGGCTTGTGACCAGAAACAGTAGGTCATCTTTGAAGGTCCACTCCCGATCCTGCCATGATCTGTCCGTGCTCTGA
Full Trace Sequence: cacatattgatctgtagtggaatagagacatcagggatagacgctgggctggttacaccaataggacacacaacccaaagatgtgcgcctcacgagctcccctgaggaggcgggccagcaccccattaccttgtgcccatcagaaccgccagcgaggagcaactcccataaggaagctatactcaccttctaaagctgctgggagtgcccactgcagtggctccttagactcaggggtctcggatgggagaaacgaggcccatttaagagtggtactacttggagacccaggggttggaaagtccagtcttgtggccatctttcgaagggagcaggatagagaagcagcagaacagcagctagaagtgtttgattgcaccctgatggtggacggcaaggagaccaccctgctggtcatggatacggatgaacgcaacatgaagaaagccatcgagagcagtgatagccccatgcgcctcggcaacgcctacatcatcgtgtactcagtcactgatagggccagctttgagagcgcgtcagaacttcgaatacagcttagaagaactcgtcaggctgaaaatatcccaataatccttgttggcaacaagacggaccttgtccgcagcagagaagtttctgtggaagaaggtcgagcgtgtgctgtggtgttcgactgtaagttcatcgagacctctgctgtcctacagcacaatgtccaagaattgtttgaggggatggtgcgccagatcagattgcgtagagagggggcagacacagctgagggttttcgcatgcagagccaacgcaaggagagtctgaccaagagggcacgaaggttcttggaccggcttgtgaccagaaacagtaggtcatctttgaaggtccactcccgatcctgccatgatctgtccgtgctctgataagctcctcagggagaaggccacccagaatgagctcagatatcaactaaatgcttttgagccatgcagaacataatggacactgatgggacactgtactggctggacagctagcatgaaggacacttaccactcatgaactgattatttgtgcactgatggacagttaccaccccaagaccaggatgaagcctgcaatgaagttcatcacaactgatacctttctaatgtcagcctaatacctacttgcaccaagctcattgatgtatttgaaatgccattctgccccatctctgtggcttttgtgtaagtagaatgaaatatctggtgaggttctaccatttctgactctgagagaatgtagaaagtcaggaaactctccctccccctacaaggttctatggaactatgccaagcacccactaaattcagcactgagcaaacagtggaaaatctgagcagaatgtttatggatggaggctgagagaggctgcacggagagatggggagtggggggcgtaaatggataagaataaacatcatgatcattctactaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCASRAPLRRRASTPLPCAHQNRQRGATPIRKLYSPSKAAGSAHCSGSLDSGVSDGRNEAHLRVVLLGDPGVGKSSLVAIFRREQDREAAEQQLEVFDCTLMVDGKETTLLVMDTDERNMKKAIESSDSPMRLGNAYIIVYSVTDRASFESASELRIQLRRTRQAENIPIILVGNKTDLVRSREVSVEEGRACAVVFDCKFIETSAVLQHNVQELFEGMVRQIRLRREGADTAEGFRMQSQRKESLTKRARRFLDRLVTRNSRSSLKVHSRSCHDLSVL
Donor tissue: embryo