ORFeome > rgs4 – XORFeome 2.0

rgs4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis regulator of G-protein signaling 4, mRNA (cDNA clone MGC:76188 IMAGE:5335841), complete cds
Gene Symbol: rgs4
Gene ID: 394913
ORF gb_acc: MG132814
ORF ID: 10159

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064234

Library Location

Plate ID: GDExt11002
Well Location: B04

EST Sequences

Clone: MGC:76188 IMAGE:5335841
Trimmed Sequence: ATGTGCAAGGGACTAGCTGGAGTGACCGCTTTCCCTGCCACCTGTCTGAAAAGTGCTAAAGATATCAAGCACCGCTTGGGATTCCTGCTGCAGAAAGCAGATGGGTGTGAACACAGCCCATGTGTAAAGAAAGACAAACCTGGTAGCCAGAGGCTGAGACAAGATGAAGTTAAGAAATGGGCTGAATCTTTGGAGAACCTGATAAACAATGAATGTGGTTTGGCAGCTTTTCGGGCCTTCCTTCAATCAGAATACAGTGAGGAAAACATTGATTTTTGGTTAGCCTGCGAGAATTACAAAAAAGTCAAGACCCCAGAAAAGTTACTTGAGAAAGCTCAGAAGATCTATGAAGACTTCATCTCAGTGGAGGCCACAAGAGAAGTTAATCTGGACTCAGCCACACGTGAGGAGACAAGCAATAATATCATACAACCCACACATTCTACCTTTGACGAGGCCCAGCACAGGATATTTATCTTGATGGAGAAGGATTCCTACCGACGCTTCCTCAAGTCAAAATTCTACCTTGATCTTGTACTGAGCAGCAGTGGGGCAAGCACCAAGAAGATGAAAGTTCTCACCACAGACAGTAACCCCTTCATCCCGCAGTGTGCTTGA
Full Trace Sequence: gacagatccagcgagacagacatacgacagagatctaacagcagcagagtctgggaacctgatcttacttcaaggatgtgcaagggactagctggagtgaccgctttccctgccacctgtctgaaaagtgctaaagatatcaagcaccgcttgggattcctgctgcagaaagcagatgggtgtgaacacagcccatgtgtaaagaaagacaaacctggtagccagaggctgagacaagatgaagttaagaaatgggctgaatctttggagaacctgataaacaatgaatgtggtttggcagcttttcgggccttccttcaatcagaatacagtgaggaaaacattgatttttggttagcctgcgagaattacaaaaaagtcaagaccccagaaaagttacttgagaaagctcagaagatctatgaagacttcatctcagtggaggccacaagagaagttaatctggactcagccacacgtgaggagacaagcaataatatcatacaacccacacattctacctttgacgaggcccagcacaggatatttatcttgatggagaaggattcctaccgacgcttcctcaagtcaaaattctaccttgatcttgtactgagcagcagtggggcaagcaccaagaagatgaaagttctcaccacagacagtaaccccttcatcccgcagtgtgcttgatacacaagacactactgtgctctaagaacttagcatctatgtgctcctatttatactgtacgatggctcagaagtggtgtcgagccagctcctcatatttattacatatgtgtgtgagtgttgcatgcatttcatgtcatattggggtgagctggaaaaatcgcatagacctatgggtttttgttgcaggattatgactcactggagagctgggaatgcagattccacacaacactctcaggcattatttgtaggtggctttgcactgaatcctttaagttacctttgttataccagtattcccaagaatggtgcccattttattttgcactgaccaggttagtttatcatcctgaaaactagcctttcacatactctcacaacacagtgtcaataattcccctgtggtagtgaagcatagattgtatactatatgcttgtgccactatacattctaaacagggacattttgcacctcggcacccacaaggcttcatgtttattgggcgtattgaggaagactactggttaaggcagacaattctgctcatcagttacacactattagattagtaagagctgttctcttagacaaagctctctgtgacttaacaattattatttttttaacaaatatattgttgtcctctcctttttaacttatgtttgtaagaaaaaaataattgccgaaggctctccttgatcaaaaccttgttttctgaacaacagagagaactggatatggattgaggaaagtggaaatattttgtgtgagacttgctgctgaaggtgcaatcctttcattttctttaaacaagcatggatttgcctgggtactatttaacttgtgcatgcttgtagtaaattgtctgtgaaaccaaataaatatgtaatacaaaaaaaaaaaaaaaaaaaaaaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCKGLAGVTAFPATCLKSAKDIKHRLGFLLQKADGCEHSPCVKKDKPGSQRLRQDEVKKWAESLENLINNECGLAAFRAFLQSEYSEENIDFWLACENYKKVKTPEKLLEKAQKIYEDFISVEATREVNLDSATREETSNNIIQPTHSTFDEAQHRIFILMEKDSYRRFLKSKFYLDLVLSSSGASTKKMKVLTTDSNPFIPQCA
Donor tissue: tailbud