ORFeome > rhbdl7 – XORFeome 2.0

rhbdl7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis rhomboid, veinlet-like 7 (Drosophila), mRNA (cDNA clone MGC:89437 IMAGE:6990715), complete cds
Gene Symbol: rhbdl7
Gene ID: 448627
ORF gb_acc: MG133857
ORF ID: 11438

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076969

Library Location

Plate ID: GDExt11014
Well Location: E04

EST Sequences

Clone: MGC:89437 IMAGE:6990715
Trimmed Sequence: ATGGAGAAGTATGGCGAAGTGCGGGAAAGCTGGCGGAAGAGTGTATTGTCTTGGCTGCCGCATGTGCAGCTTACTACCGGGGTTGTTCTGACTGTGCTGACTTCTCTAATAGTTTCGGCTCCGGCGCTAATTAAAGTGGACAATAAGGATGATGTGGGACCTCTGTTTGATTTAGAGCCTGGGTCTCTGGGAATCACAACAGGGTACAAATTGTTCATCTACATCTATTTCCATGAGGATTTTTCATCTCTGGTGTGCAGCACCCTGATAATTTGGTTCTTTGGAGGAGGCTTTGAGGAGAATGTCGGTACAGCAAAGTTTTGGCTTCTTACACCTTTCTTCGCAGTATCTTCAGGACTTCTCTACCTGGCAATCCTGGCCACAGGCCTCAGTTTTCAAGCAAATGTGACAGTCCAAGGCTTCACAAGTGTGGCCTTTACCATGCTGAGTGTATTTACCATTCGCTCCCATTTCAAACGCATGTTGTTCTTTGGGTTCATGGTACCAACTAAAATGCTGCCTCTGTTCTTTCTAATCCTGGCATTGTTTCTTCCTCATGCTCCAGTTCTCAGCAATGTTTGTGGAATTCTAGTTGGCATTGCTTATGGCATGAGTGGCTTCTTTTGTCTTGATCTTCCGGAATCGATAATGTCACGAATAGATCAGATATTTCTGTGTAGATTACTGAAACGCATTCCAATTTGGACTTATGTGCCTGGTTCTTCTGCTGAGAGGAATGCTGCTCAAAGTAGGAAGATAAACCCACCACCAGGATCCTACCCTACACAGCAGTTTTACACTACTCCTCAAGGACTCCATGAGGCCTATTCACCATATCACAACCCCAAAGCTTCTGGACTTGTGTCCCCAGCAATGGCACCTGTGGGCCCCTCACCATATTCCATGACTTCTCCTCCAGGGGCATTTTATCAGACACATCATATGTGCTCAGGGGGACACTCTCATTTAGATGCTTCCACATCTACAACTGTAGGTGGAGTTGGTGTTCCACCTGGTAATGATTTGCAGCAAGTACGGACACAGTAA
Full Trace Sequence: catcgcggaagtaatgtaaactctgcacgttgttgcggacttagttgacttattattcggccatggagaagtatggcgaagtgcgggaaagctggcggaagagtgtattgtcttggctgccgcatgtgcagcttactaccggggttgttctgactgtgctgacttctctaatagtttcggctccggcgctaattaaagtggacaataaggatgatgtgggacctctgtttgatttagagcctgggtctctgggaatcacaacagggtacaaattgttcatctacatctatttccatgaggatttttcatctctggtgtgcagcaccctgataatttggttctttggaggaggctttgaggagaatgtcggtacagcaaagttttggcttcttacacctttcttcgcagtatcttcaggacttctctacctggcaatcctggccacaggcctcagttttcaagcaaatgtgacagtccaaggcttcacaagtgtggcctttaccatgctgagtgtatttaccattcgctcccatttcaaacgcatgttgttctttgggttcatggtaccaactaaaatgctgcctctgttctttctaatcctggcattgtttcttcctcatgctccagttctcagcaatgtttgtggaattctagttggcattgcttatggcatgagtggcttcttttgtcttgatcttccggaatcgataatgtcacgaatagatcagatatttctgtgtagattactgaaacgcattccaatttggacttatgtgcctggttcttctgctgagaggaatgctgctcaaagtaggaagataaacccaccaccaggatcctaccctacacagcagttttacactactcctcaaggactccatgaggcctattcaccatatcacaaccccaaagcttctggacttgtgtccccagcaatggcacctgtgggcccctcaccatattccatgacttctcctccaggggcattttatcagacacatcatatgtgctcagggggacactctcatttagatgcttccacatctacaactgtaggtggagttggtgttccacctggtaatgatttgcagcaagtacggacacagtaaatatttatagctcttggacaagtttaatacctggtagcaacagattggattttcacaagaagcaaacactattccatgtaatagaaagcaacattttgtgtgtccttaaatgttatataactcctacctgctactgtttttcaggtacctgaatacatatactagtgtgcctgtctgctgctactaaccagtttaagccttaatattacatttcctatggagaaatcaaaaatgtggggcccagtcattaaagcacgattgctttaaagttctaattgttagaacttttcgtattgaccatgatattgttaaaatagtatgactttttcgtggttttcgttaaattccacgaaaaagtcatatttttcacaaagactacgaccatttcagaattcatttaagctttggtattgtgactttattttggccaggttggagatgtagagtgccattggaaggcttccaaaatcatgcattgaagtttcagaaaggtttttgctccatttacgatcgttcagatacaaaaattttgtgagaatttttgcacatcagaaattattgtggttactgcaaattttttccaattgtgcttttcattggtgaaaatgtgtgctttaatgaatgggcccctatgtgtgtcattggactgaaattctctgatttgcactgagtagttatgttagataggataccttttattttgcactcaacaaagctcaaaatatgttgctcttatttgaaggggcattttattttcttgtataagcaattttattagagtttgtattcatggctatatttaacaagtgtccttgttaatggggaaatacccctctactaatttacagatgatgcaggatctgtacatgctgtaaaagggtcagtagtaacaaaatcataagcaagttctttctaaacatgcatttacagcttttactacatccttaatgaaactctactaccttcatggggcagtctcatagggtagtctcctagggtccatgttaatggctataattgtattggggagcgtatcattgcctggataggttacaatatagtgcaattgaagactacagagttttacaccattttgttctgtcactttttctttgtaaatatacccagtgaccattctttctgatagcctgtcaaagagtattaacttcccttggttctatagtcttgccagtttttaaaggagaaggaaaagctaagtcactggaggggttccaagctctgagtggctgtttggtagcccctttgttgattggcagcctacaggaagctctgtttagaactacagcaggttttatgcaaaaaaaaaaagcacctatctacactttgcactttattttatgacaactgaagtagttgtcactatatacatggattatagaatgtcatggtacaaatcgcttaaatatgattgcatgctttaaagcagtggttggagtagaatgtctttattgggctttggagaaaataatttttgtgggactctctctatttgttaacattatgttttaggcttcaatacctgcccaaagcaaccacagccctttagcagggaagatctgtgcctccaaagatgtccacagtagctccccatcttcttttctgctgattccctgcacgtgctctgtgctgctgtcagttactgagcttcggggctgactcactgaatacctaggatataaatgtaactgtataaggctgattattattaaatgtcagctctgaaaccaatgaaattggcatcagaatttaaaggaatactgtcatggaaaacaaaatgcatcagttaatagagctgcgccagcagaatcctgcaaaacattttttttgtcacatggggctagccattctctttatttcccagggtgccacagccatgtgacctgtgctctgataaacttcagtcacactttactgctgagcttcaagttggagtgttatcacccccctcccagcagccgatcagcagaacaatgggaaggtagcaagatagcagctcccagtagatatcagaatagcactcaatagtaagaaatctttggcttgggactcctccagttacatgggagtaggagaaacaataggttatctgaaagcagttctactgtgtagcgctggtttattatctggcacaatgcactgtgatggctgcctacacaccaatattacatctaagaataaattttaaaatggtagagtggaatatttgctgtgtaatttaataaacctaattttttaagccctgagctaaacatctccacagctgcccagaatgcactgagcatgtgcagtgtcacaaatttgaaggcctggatcattgcttctatagagaggctaaacctttggactgatgcagtaagttcaatatcctgtatgaaatatggtatttctacccatatttgtttttagggtttagttctcctttaaacatggaagctggcgcaagaatatatcagaattagaagttatctgtgagaaaatgtgtgcaaaaatcccttccacaagaacttcaaactttttttgtcaagctgtacctaaatgttgacttactaggatgtccaaacagttgcacatgccacaatttctgttttatttgttactacattttaaagtatttgaaataaaacatttgcaaatgtttgctttttttaacacatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEKYGEVRESWRKSVLSWLPHVQLTTGVVLTVLTSLIVSAPALIKVDNKDDVGPLFDLEPGSLGITTGYKLFIYIYFHEDFSSLVCSTLIIWFFGGGFEENVGTAKFWLLTPFFAVSSGLLYLAILATGLSFQANVTVQGFTSVAFTMLSVFTIRSHFKRMLFFGFMVPTKMLPLFFLILALFLPHAPVLSNVCGILVGIAYGMSGFFCLDLPESIMSRIDQIFLCRLLKRIPIWTYVPGSSAERNAAQSRKINPPPGSYPTQQFYTTPQGLHEAYSPYHNPKASGLVSPAMAPVGPSPYSMTSPPGAFYQTHHMCSGGHSHLDASTSTTVGGVGVPPGNDLQQVRTQ
Donor tissue: gastrula