ORFeome > rhoa – XORFeome 2.0

rhoa – XORFeome 2.0

General Information

Species: Xenopus tropicalis ras homolog gene family, member A, mRNA (cDNA clone MGC:69542 IMAGE:5336646), complete cds
Gene Symbol: rhoa
Gene ID: 448080
ORF gb_acc: MG133344
ORF ID: 10846

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074607

Library Location

Plate ID: GDExt11009
Well Location: F01

EST Sequences

Clone: MGC:69542 IMAGE:5336646
Trimmed Sequence: ATGTGCTTTTCCATTGATAGCCCTGACAGTTTAGAAAACATACCTGAGAAATGGACCCCGGAGGTGAAACATTTCTGCCCCAATGTGCCGATTATTTTAGTTGGAAATAAGAAGGATCTGCGTAATGATGAACACACTCGTAGGGAGCTCACCAAAATGAAACAGGAGCCTGTAAAGCCTGAAGAAGGTCGTGACATGGCAAACCGTATCTCAGCCTATGGCTACATGGAATGCTCTGCAAAAACGAAAGATGGCGTGAGGGAAGTGTTTGAGCTGGCTACGCGGGCAGCCCTGCAAGCCAGGCGTGGCAAGAAGAAAACCACGTGCCTTCTCATCTAA
Full Trace Sequence: gtgtgaactaataacggccgccgcccgtgggagggacggaaaacacgagttatataccgtgtgtaacggagcggtgagcgtgtccggcgaagccagtctctaccggaatctgaaagcggcttagcgaggcctaagaaatggcagccatccgtaagaagcttgtgattgtgggagatggtgcatgtgggaaaacctgcctgctgattgtgttcagtaaagaccagtttcccgaggtgtacgtcccaacagttttcgagaactatgtggcagacatagaagtggatagcaagcaggtggagttggccctttgggatacagctggtcaggaagattatgacagactgtgacctctgtcctatccagacactgatgttatattaatgtgcttttccattgatagccctgacagtttagaaaacatacctgagaaatggaccccggaggtgaaacatttctgccccaatgtgccgattattttagttggaaataagaaggatctgcgtaatgatgaacacactcgtagggagctcaccaaaatgaaacaggagcctgtaaagcctgaagaaggtcgtgacatggcaaaccgtatctcagcctatggctacatggaatgctctgcaaaaacgaaagatggcgtgagggaagtgtttgagctggctacgcgggcagccctgcaagccaggcgtggcaagaagaaaaccacgtgccttctcatctaaccgagaaacctgccgtattgcacacacacaacctattcccatactccactgggggactgggagccatcgtgcagcaagggttaagcccacggcaaaacgtacagtcacagaaaaatcctggaagggatgtttattaatctttagagtgttcttactggcctttttgtctttttcatttattctgttatgagattttataaaaaaaaaaagtcatcttgctaccagtatttaaaagtcaacgttttttctttgatatataaatatataatatgtaacttcactgttagcagatttgtccatgcaccagactaactctgacattccactgtaaatcccagtctgcaccagggaattctgataccagactggcttcctttatttctcctaagcttcattttgtcatcccccttccaccctattaatatgtgctcctgcctttaatggtgtagtaatatatgttgcacttttgtttttgccatcactttgctaattgaacaggacagcggtttcggttcaccttttagttgatagcaacatggcaggagcggtgtttacgtcacagggctactttagtttttccttccctgtgtacagagttaaagctgctctactaaaactgtataatgtgtcaagaagtcattgatcccattgagcctcctgcttcttaatttgacgagggcgctaagtgttcatgcagacaggctccatatgaaatgagagacggccgtttttatacaagtctctgaacatggtggcaaaagttaccaggggctcatataaaaaatgaaaaaaaggaaaaaaaaaaaacttcccaatggcgtagtttagcagtcaagcactacagaagttgttgcctttgaatcactgtcctgggggggtgtcacgtggcctacatgggagagcgattattcgactgtaacaatactgctgcagtgtctagaggggaaaacttactgttgctggaatggtctgcaacaggttgctttgcaatgcattttaaacccttttgtagcaaaaggggttaattatctttgggtacactgacttgttttaattttttgtggcattggttaataaaaatttctagaaccgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFELATRAALQARRGKKKTTCLLI
Donor tissue: tailbud