ORFeome > rhob – XORFeome 2.0

rhob – XORFeome 2.0

General Information

Species: Xenopus tropicalis ras homolog gene family, member B, mRNA (cDNA clone MGC:69411 IMAGE:5335504), complete cds
Gene Symbol: rhob
Gene ID: 407883
ORF gb_acc: MG133265
ORF ID: 10749

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067992

Library Location

Plate ID: GDExt11008
Well Location: H01

EST Sequences

Clone: MGC:69411 IMAGE:5335504
Trimmed Sequence: ATGGCCGCGATACGCAAGAAGCTGGTGGTGGTCGGGGACGGAGCTTGCGGCAAAACCTGCCTCCTCATCGTCTTCAGCAAGGACGAGTTCCCCGAGGTGTACGTTCCCACCGTGTTCGAGAACTACGTGGCCGATATCGAGGTGGACGTGAAGCAGGTGGAGCTGGCCCTGTGGGACACGGCGGGGCAGGAGGACTACGACCGGCTGCGGCCTCTCTCCTACCCCGACACGGACGTCATCCTCATGTGCTTCTCCGTGGACAGCCCGGACTCGCTGGAGAACATCCCGGAGAAGTGGGTGCCCGAGGTGAAGCACTTCTGCCCCAGCGTCCCCATCATCCTGGTGGCCAACAAGAAGGACCTGAGGAACGACGAGCACGTCCGCAACGAGCTGGCCCGCATGAAGCAGGAGCCGGTCCGCACCGAGGACGGCAGGGCCATGGCCGTGAGGATTAACGCCTTCGAGTACCTGGAGTGCTCGGCCAAGACCAAGGAAGGGGTCCGGGAGGTGTTCGAAACGGCCACTAGGGCGGCGCTGCAGAAGAAACACGGCCGGAGCGGTGAATGTATGAGCTGCTGTAAGCTCCTCTGA
Full Trace Sequence: gagagccgagcggtgtggttgtgtgtgagagagctgctctagcggtaccggcgtgtagtaccgaggaactgcatcctacagacccgtctctttctgagaggcctcgccattagagccataggcaagctgagaaagcaccgggcagcctctagcagcagcagccgggcagccatggccgcgatacgcaagaagctggtggtggtcggggacggagcttgcggcaaaacctgcctcctcatcgtcttcagcaaggacgagttccccgaggtgtacgttcccaccgtgttcgagaactacgtggccgatatcgaggtggacgtgaagcaggtggagctggccctgtgggacacggcggggcaggaggactacgaccggctgcggcctctctcctaccccgacacggacgtcatcctcatgtgcttctccgtggacagcccggactcgctggagaacatcccggagaagtgggtgcccgaggtgaagcacttctgccccagcgtccccatcatcctggtggccaacaagaaggacctgaggaacgacgagcacgtccgcaacgagctggcccgcatgaagcaggagccggtccgcaccgaggacggcagggccatggccgtgaggattaacgccttcgagtacctggagtgctcggccaagaccaaggaaggggtccgggaggtgttcgaaacggccactagggcggcgctgcagaagaaacacggccggagcggtgaatgtatgagctgctgtaagctcctctgatcccccccggactcatcctgctctgcacagaggggacattccgcctgagacactattgcttccggtagtacagggagaggggggactgcccttccctgggacccagctcagagccacaggggctgctaccccacagctgagccgccatcatggaacatggagaatgagtggggtattggggcatcaccatgggcatctccttgccccagagcctcagtattaccctgtacataggacttctgtctctccatcttgtcatgccttgtgggggggagaagctgcatgggctgtaccccaactgccatcttttctaccccctttgtgccctttaatgtttcacgctcagggcagcggggagttgtgtagctgttccacgtagtcgccctcatactgttacattgggggttattcctatagccacattggctagcaaaccccgcaatccggctacgagcagcagctacaaaactgtcatttgctgagctgtaactgtgacccccccccccccaggggtagagaggcattaaccacttcagtgctgaactaaaaccagctgtgcattgattgctgggctctcccattgcaccaaagggggcaggggggaatacttttggatacatttttgttctgaatgatcagaaccgggtaaaatgtttttctgtgactttcgcaaatttaatttttttttttgcacattttccccctttatttttgacgtttaacgcacttgccatcctcaaaagtgtaacactagggactcattctttgcacactgatctgtcctttaataactgcggcatggcgtgttagtgcagcggcacaaggggcaacgtgggggtgctctaacggccacttggtgtttagtagccccccatagaatgtaatgagaagtgctgagggtgctactattgcaccgtgctacagaaaaatgcagcacaaagtgcccaatgttgccccatgtgctgtggcccttagccttcatgcctcccaacagctcttagccacagtctggggaatgttgggagttgcagttgagtcgttatgttttccttattctgcaactgacactacattgttaaagtccagtttgggggagggggggggtaaaaaagctatttttggacagtggtactaaatttgtgattttcaagacaaaacaaagctgacagaacagtatgaaatgaatttttgaatgtttacataaaatgttgatatgtatatattggtttttatgtgaaatattaaaaaaaagcactatgtaaacctaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDVKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPSVPIILVANKKDLRNDEHVRNELARMKQEPVRTEDGRAMAVRINAFEYLECSAKTKEGVREVFETATRAALQKKHGRSGECMSCCKLL
Donor tissue: tailbud