ORFeome > rnf11 – XORFeome 2.0

rnf11 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ring finger protein 11, mRNA (cDNA clone MGC:89047 IMAGE:7005382), complete cds
Gene Symbol: rnf11
Gene ID: 448572
ORF gb_acc: MG134143
ORF ID: 11773

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076905

Library Location

Plate ID: GDExt11017
Well Location: H10

EST Sequences

Clone: MGC:89047 IMAGE:7005382
Trimmed Sequence: ATGGGGAACTGCTTGTCCTCCCAGGCTGCCGATGATCTGTCCCTGCTCAACGACTCGGACGGTGCCAGCCTGCCCGGGGAGCCCCCCCCGCCTTACCAGGAGCGAGAGCCTGTGCCCGTTTACCACCCCACACCCAGCCAGACCCGCCTGGCCACTCAGCTGACTGAGGAAGAGCAGGTGTGGATTGCGCAGAGGATTGGGCTCATCCACCATCTCCCCAAGGGCAGATACGATCCGGGCTCTGGCCCCGCAGAGAAGAAGCTCAAAGAGTGTGTGATCTGCATGCTGGACTTTGTCGGCGGAGATCCGGTCCGGTTTTTACCCTGCATGCATATTTACCACGTGGAATGTATAGACGACTGGCTGATGCGTTCCTTTACCTGCCCATCGTGCATGGAACCAGTGGATGCCGCTTTGCTTTCATCCTATGAGACAAACTAA
Full Trace Sequence: cagcccgatgatgtcattgtgtcggtgaggcgcggagcatgctggggagtgtagttcttggcactgttatttccggaacttgcggctggggaaatagcttgaagctgctctgggagttttggggcggccctagggcccctggagcggggagatggggaactgcttgtcctcccaggctgccgatgatctgtccctgctcaacgactcggacggtgccagcctgcccggggagccccccccgccttaccaggagcgagagcctgtgcccgtttaccaccccacacccagccagacccgcctggccactcagctgactgaggaagagcaggtgtggattgcgcagaggattgggctcatccaccatctccccaagggcagatacgatccgggctctggccccgcagagaagaagctcaaagagtgtgtgatctgcatgctggactttgtcggcggagatccggtccggtttttaccctgcatgcatatttaccacgtggaatgtatagacgactggctgatgcgttcctttacctgcccatcgtgcatggaaccagtggatgccgctttgctttcatcctatgagacaaactaaagagagacggttggtctctggcagggggcggacacacctgagactaatgtaacaagaggcagcttcctaatgtgcagaactcaagaattaccctcattgggggagaaaagctgctgtagcgaggaacagccacatgggggcagcgcagactattttctagtcctactaaacccactccttgtgcaacgagcccccctggcagagcagacgtcacactgatggacagtcagcccccgtccctgatgagccgcttagatgtgaactgcagtgatggaatcatgagattgctgatgcagggagtagtacggacagaactgcaccgtctctgcggggaggggaggcctttgagccgcagccgggaatgctcttcagagtaagagctggtctgtaatctaatgatctgcttattgttatttttgggggtgagacatggctgaatattcaaaattccgaaacagtgggatttctttcatatcacattattacctgtacaactggttgtgactcctgaaacaaagtagcagaagccagcagaaccccgcagccctgtgaggcaacaattattagttttaatacttagctttctgattaggcctttcctattcattttcaaaactactgcctggttgctatggcaaatgggaccctagcgagcagatagctgcctaaatacacgtaccaattgcgatctctcctgcactcgcattctccactaacgttcagggctgaatcgtcagatatggaggtagaaacaataggaattctacccctatctgacgaacataaagaccaattgcatctgaatatctctaaagtcttaatatttaccaaaaccgcccctttaaagctggcttctactttgctttctttgtattaatattttttaaaggggaagtcagcctttgacagtgtaggaagcagtctaagatgctatgggccattttaaaatttggaatttccagtgaacttgctatctggttcctgggagcagtaaccccgtgatattaatagtagtttgcaaggaaaagccattatcaccaaagccccaactgctgaacttcccctttaaaacactgccaattgttctcatagtgttttgggttgttttaactataaatataggattaagacgagacgactggcacagcccagttaatatgcagctgccatggtccaagcagggaatgcccctgtatatttcactgatcagtaccaggatatttcagttgctcctgattggttcctcagcaccagaacctcccacttctttttctgcagacaaaagactataggagacatttctcatttacgatcttaattaaaataaagtcttaatttccttttgtccaaagagaacccacttatagagcaatgtgctcagtgggggaaaagaatgtacggctgaagctgctgatgaaccccccccccccaatattttgctgctaagcagtgtggatctttgcacactggcccgggatacatagagctttgcgagttcaaaataaacatgctgtgcgtggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGNCLSSQAADDLSLLNDSDGASLPGEPPPPYQEREPVPVYHPTPSQTRLATQLTEEEQVWIAQRIGLIHHLPKGRYDPGSGPAEKKLKECVICMLDFVGGDPVRFLPCMHIYHVECIDDWLMRSFTCPSCMEPVDAALLSSYETN
Donor tissue: