ORFeome > rnf14 – XORFeome 2.0

rnf14 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ring finger protein 14, mRNA (cDNA clone MGC:89429 IMAGE:6990508), complete cds
Gene Symbol: rnf14
Gene ID: 493480
ORF gb_acc: MG133862
ORF ID: 11444

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC081322

Library Location

Plate ID: GDExt11014
Well Location: H09

EST Sequences

Clone: MGC:89429 IMAGE:6990508
Trimmed Sequence: ATGTCAAGAGAAGACAAGGAAGCGCAGGAGGATGAACTGCTAGCACTCGCTAGTATATACTCTGAAGATGAATTCAAGAGATTGGAGACTGCACCAGGAGGGGAAATATGTGTCTGTCTAGATCTTCCTCCAAACTTTAGCGTAGCCATAAAAGGTGACTGTGCATCTAATGAATACATGGGAAGCTTTGAGAGTATTGTCTCTTTCCTACCTCCTATCATACTGGACTTTGAACTGCCTCCAGGATACCCATCCACTGACCCTCCAGCCTTCAAACTTAGCTGCAAGTGGCTTTCTCCAAGTCAGCTTGCCCTGCTGTGTCAGCGCTTGGATGACCTATGGGTGGAATACGCAGGAGAAGTTGTTTTGTTTGCTTGGATGCAGTTTCTCAAGGAGGGGACTCTGGAGTACTTAAAGATTAACTCACCATATGAAATACAACTTTGTGAGTTTGGACCAAAGTGCATAAAGAATAACTTGGGGATATCTGATTCCTGTAGTGCCACAGGCCCAGCAGAAGCAGTGATTTGGGACACACGTGCTATCCAGGATGTGGAATCTGTCACTACCCTTATTGACTGCATCTTGGACTTTAATGAGGCTCAGCAGAAGAAGTGCTTTGATAGCAAATCATATATGTGCGACATTTGCTTCTCAGAAAAGGTGGGCAGCGAGTGCACTCACTTTAAGAAGTGTGAGCATATCTACTGCAACGCCTGCCTTAAGGATTATTATACAGTTCAGATACAGGATGGGCAGGTCCAGGCTCTTAACTGTCCTGAGCCAAAGTGCTCTTCTGTTGCTACACCTGCACAGGTGAAGTTGCTGGTTGGGGAAGAATTGTTCAGCCGCTATGACCGTCTTCTACTGCAGTCCAGCCTGGATCTGATGGCAGATGTGGTGTACTGCCCACGTCCAAACTGCCGAACTCCAGTCATGCTGGAGCCTGGGGGCGAAATGGGTATTTGTTCCAGCTGCAAGTACGCTTTCTGTACCCTCTGCAAATTGGCCTACCATGCAGTCGCATATTGTAATATAACATCAGAAAAGCTTCTGTTAGTGCGCGATGAATACCTGGAGGCAGATGCGGCTGGAAAGAAGTTACTGGAAAGGCGCTATGGCAAGAATGTGATAGTTAAAGCAGTGGAGATGAGATCTTTTGAATGGCTGGAGAAGAATTCCAAGCGTTGCCCAAGCTGCAGAGCCAATGTAGAGAAAATAGATGGCTGCAACAGGATGTTTTGTACAAGATGTAACAAAAACTTTTGTTGGCTTTGCTTGGCTGTATTATCCAACGGAGACCCATATGATCATTTCAATAGTTCTTCATCAGGCTGCTTCAATCTATTGTTTGAGCCACAGAAGGCATGA
Full Trace Sequence: ggttggaccagttatgtcaaagggttgtgccatttaccatggagtgcagaattgcgcatcgctgtaaaatctgacgctgcagtggctgcttccccgctgtaactccgagcaatgaagcgaatggatcctccgaacctgcaggtgccagtgtatctccgcaaagttgccgggagtcgcatcgctacttgcctgtgacagtgcggctttgtacccggaagcgcggcggctacaggcacattggcgcagatttgcacagacaaccaatgtcaagagaagacaaggaagcgcaggaggatgaactgctagcactcgctagtatatactctgaagatgaattcaagagattggagactgcaccaggaggggaaatatgtgtctgtctagatcttcctccaaactttagcgtagccataaaaggtgactgtgcatctaatgaatacatgggaagctttgagagtattgtctctttcctacctcctatcatactggactttgaactgcctccaggatacccatccactgaccctccagccttcaaacttagctgcaagtggctttctccaagtcagcttgccctgctgtgtcagcgcttggatgacctatgggtggaatacgcaggagaagttgttttgtttgcttggatgcagtttctcaaggaggggactctggagtacttaaagattaactcaccatatgaaatacaactttgtgagtttggaccaaagtgcataaagaataacttggggatatctgattcctgtagtgccacaggcccagcagaagcagtgatttgggacacacgtgctatccaggatgtggaatctgtcactacccttattgactgcatcttggactttaatgaggctcagcagaagaagtgctttgatagcaaatcatatatgtgcgacatttgcttctcagaaaaggtgggcagcgagtgcactcactttaagaagtgtgagcatatctactgcaacgcctgccttaaggattattatacagttcagatacaggatgggcaggtccaggctcttaactgtcctgagccaaagtgctcttctgttgctacacctgcacaggtgaagttgctggttggggaagaattgttcagccgctatgaccgtcttctactgcagtccagcctggatctgatggcagatgtggtgtactgcccacgtccaaactgccgaactccagtcatgctggagcctgggggcgaaatgggtatttgttccagctgcaagtacgctttctgtaccctctgcaaattggcctaccatgcagtcgcatattgtaatataacatcagaaaagcttctgttagtgcgcgatgaatacctggaggcagatgcggctggaaagaagttactggaaaggcgctatggcaagaatgtgatagttaaagcagtggagatgagatcttttgaatggctggagaagaattccaagcgttgcccaagctgcagagccaatgtagagaaaatagatggctgcaacaggatgttttgtacaagatgtaacaaaaacttttgttggctttgcttggctgtattatccaacggagacccatatgatcatttcaatagttcttcatcaggctgcttcaatctattgtttgagccacagaaggcatgaagcctaaccatcagggcataagaaatcttggaaaagacgcactgtaatggccctgttattgtctcctttattttaaaatgggtttttccttaatgttggctcattgtttatgatcgctacttttaaatatattctctgaggtttttttttcccataggatacgcttgtttacatctgccaaatcacttgccttgtgaggagtgatgaatagtctatgctaagggcgaggacagacaaagcgcagatccacttctctcaggcctgcatttttctgccggactgagagaagtggatccgctttaatgcgctcctctgtgtgcctgcactaaaggctatggcaactgtgtgtgtgtgtgtgtgtgtgtgtgcgcacacagagtggattggaggttggcctggaaaacgcaaaagtgaacatttttcaggccaacctccaatccgctccactctgtgcccttatacccttccatacttccatatcataggaatttatatgctccattcaccaaaaaaaaaaaaataattaaaacaaaacaaaaaatgaataaaaaaaatataaagaaagaataaaaaaaaagtgaacaaaataacaataaaaaaaaaaaaaaaaaaaa
Translation: MSREDKEAQEDELLALASIYSEDEFKRLETAPGGEICVCLDLPPNFSVAIKGDCASNEYMGSFESIVSFLPPIILDFELPPGYPSTDPPAFKLSCKWLSPSQLALLCQRLDDLWVEYAGEVVLFAWMQFLKEGTLEYLKINSPYEIQLCEFGPKCIKNNLGISDSCSATGPAEAVIWDTRAIQDVESVTTLIDCILDFNEAQQKKCFDSKSYMCDICFSEKVGSECTHFKKCEHIYCNACLKDYYTVQIQDGQVQALNCPEPKCSSVATPAQVKLLVGEELFSRYDRLLLQSSLDLMADVVYCPRPNCRTPVMLEPGGEMGICSSCKYAFCTLCKLAYHAVAYCNITSEKLLLVRDEYLEADAAGKKLLERRYGKNVIVKAVEMRSFEWLEKNSKRCPSCRANVEKIDGCNRMFCTRCNKNFCWLCLAVLSNGDPYDHFNSSSSGCFNLLFEPQKA
Donor tissue: gastrula