ORFeome > rpl5 – XORFeome 2.0

rpl5 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein L5, mRNA (cDNA clone MGC:75757 IMAGE:5381602), complete cds
Gene Symbol: rpl5
Gene ID: 394476
ORF gb_acc: MG132954
ORF ID: 10330

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059751

Library Location

Plate ID: GDExt11004
Well Location: A03

EST Sequences

Clone: MGC:75757 IMAGE:5381602
Trimmed Sequence: ATGGGGTTCGTAAAGGTTGTCAAGAACAAGGCTTATTTTAAGAGGTACCAGGTCAAATTCCGCAGAAGGAGAGAGGGTAAGACTGATTACTATGCTCGCAAGCGTTTGGTGATCCAAGATAAGAACAAGTACAATACTCCCAAGTACAGGATGATTGTACGTGTCACCAACAGAGACATCATCTGCCAGATTGCTTACGCTAGGATTGAGGGAGACATGATTGTTTGTGCTGCCTATGCTCACGAACTTACCAAGTATGGTGTCAAGGTTGGGCTCACAAACTATGCTGCAGCATATTGTACAGGCCTGCTGCTGGCTCGCAGGCTTCTCAACAAGTTTGGCCTGGACAAGGTTTATGAAGGCCAGGTGGAAGTAACTGGAGATGAGTACAACGTAGAGAGCATTGATGGGGAACCTGGTGCCTTCACATGCTACCTTGATGCCGGCCTGACCCGAACCACCACTGGAAACAAAGTTTTTGGTGCTCTTAAGGGAGCTGTTGATGGAGGTTTATCTATTCCACACAGCACCAAGCGTTTCCCTGGCTATGACTCTGAAAGCAAAGAATTCAATGCTGAGGTCCACCGCAAGCACATCTTTGGCCAGAACATTGCCGAGTACATGCGCCTTCTGACAGAAGAAGATGAAGATGCGTTTAAAAAGCAGTTCTCTCAGTACATAAAGAATGGTGTCACAGCAGACCAGATGGAAGACATTTACAAAAAGGCCCATGCAGGTATTCGGGAGAATCCAGTGCACGAAAAGAAACCCAAGAAGGAAGTCAAAAAGAAGAGGTGGAACCGTGCCAAATTGTCTCTGGCACAGAAAAAGGACCGTGTTGCTCAGAAAAAAGCCAGTTTCCTCAGAGCTCAGGAGAAGGCAGACAGCTAA
Full Trace Sequence: cgccctaacgtttgggctgtgactctccggtcctagccccgacgggacaaaatagagcaaaatggggttcgtaaaggttgtcaagaacaaggcttattttaagaggtaccaggtcaaattccgcagaaggagagagggtaagactgattactatgctcgcaagcgtttggtgatccaagataagaacaagtacaatactcccaagtacaggatgattgtacgtgtcaccaacagagacatcatctgccagattgcttacgctaggattgagggagacatgattgtttgtgctgcctatgctcacgaacttaccaagtatggtgtcaaggttgggctcacaaactatgctgcagcatattgtacaggcctgctgctggctcgcaggcttctcaacaagtttggcctggacaaggtttatgaaggccaggtggaagtaactggagatgagtacaacgtagagagcattgatggggaacctggtgccttcacatgctaccttgatgccggcctgacccgaaccaccactggaaacaaagtttttggtgctcttaagggagctgttgatggaggtttatctattccacacagcaccaagcgtttccctggctatgactctgaaagcaaagaattcaatgctgaggtccaccgcaagcacatctttggccagaacattgccgagtacatgcgccttctgacagaagaagatgaagatgcgtttaaaaagcagttctctcagtacataaagaatggtgtcacagcagaccagatggaagacatttacaaaaaggcccatgcaggtattcgggagaatccagtgcacgaaaagaaacccaagaaggaagtcaaaaagaagaggtggaaccgtgccaaattgtctctggcacagaaaaaggaccgtgttgctcagaaaaaagccagtttcctcagagctcaggagaaggcagacagctaaatggattatgttgcgattttctaagtatttgcagcaaaaaaataaatctattaacatcaaaaaaaaaaaaaaaa
Translation: MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELTKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYEGQVEVTGDEYNVESIDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIFGQNIAEYMRLLTEEDEDAFKKQFSQYIKNGVTADQMEDIYKKAHAGIRENPVHEKKPKKEVKKKRWNRAKLSLAQKKDRVAQKKASFLRAQEKADS
Donor tissue: tadpole