ORFeome > rpl7l1 – XORFeome 2.0

rpl7l1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein L7-like 1, mRNA (cDNA clone MGC:76334 IMAGE:5380777), complete cds
Gene Symbol: rpl7l1
Gene ID: 394481
ORF gb_acc: MG132966
ORF ID: 10342

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059773

Library Location

Plate ID: GDExt11004
Well Location: B03

EST Sequences

Clone: MGC:76334 IMAGE:5380777
Trimmed Sequence: ATGGAGTCCACGCAGCCCCGGAAGCTTCCGCGCGTCCCAGAGAATCTGCTGAAGAAACGGAAAAAGTATCTGGGGCTGAAAGCAGCCGAGGCCAAGAGAGCGTTGGAGGAGAAGCGAAAGACACAGCCTGGGAAGCAAATCAAGTTCAAGCGTTTGGAAACCTTCGTACGAAACTCTCACAGGAAACTGAGGGACGACGCTCGGCTGAAGAGAATGAAGATTTATCAGAAGAAGATTCCTGGCGTCGCCACCCAGTCGCTGGCGTTTGTGGTTCGTATTACAAAAGTCGATGGAGTCAGTAACGCGGTTCTGGACGCTCTAAAGACCCTTCGCTTGGGGAAGATTTTTGCAGGAGCTTTTGTGAAGTTGACTCCCTCATCCCTCAACCTGATTCGAGTTGTAGAACCGTACGTTGCGTGGGGGTTCCCAAATCTGAAATCAATCAGAGAGTTGGTCTTAAAAAGGGGCCATTTCAGAAGGGACGGCCGGCGAGTGGCTCTGACTGACAACAACGTGATTGAGGAGCAACTGGGGAAGTTTGGGATCATCTGTTTGGAGGACGTGATCCATGAGTTATACACAACGGGGGAACATTTCCCAGAAGTCAACAGGTTCCTGTGCCCCTTCCGCCTCTCGGTGTCGCGCCATGCAGCCGTCAATCGGAAGGGCTACCTGAGCGAGGTGGGCGACCCCGGCCACAGGGGCTCCGGCATTAACCAGCTGATCCGCCAGCTGAACTAG
Full Trace Sequence: ctgcgaaagagcggaagtcgtgtagaaagaacttcctgtttgctcagttttgcggaaggagcaagatggagtccacgcagccccggaagcttccgcgcgtcccagagaatctgctgaagaaacggaaaaagtatctggggctgaaagcagccgaggccaagagagcgttggaggagaagcgaaagacacagcctgggaagcaaatcaagttcaagcgtttggaaaccttcgtacgaaactctcacaggaaactgagggacgacgctcggctgaagagaatgaagatttatcagaagaagattcctggcgtcgccacccagtcgctggcgtttgtggttcgtattacaaaagtcgatggagtcagtaacgcggttctggacgctctaaagacccttcgcttggggaagatttttgcaggagcttttgtgaagttgactccctcatccctcaacctgattcgagttgtagaaccgtacgttgcgtgggggttcccaaatctgaaatcaatcagagagttggtcttaaaaaggggccatttcagaagggacggccggcgagtggctctgactgacaacaacgtgattgaggagcaactggggaagtttgggatcatctgtttggaggacgtgatccatgagttatacacaacgggggaacatttcccagaagtcaacaggttcctgtgccccttccgcctctcggtgtcgcgccatgcagccgtcaatcggaagggctacctgagcgaggtgggcgaccccggccacaggggctccggcattaaccagctgatccgccagctgaactagagcccctgctctcagattgctgcgttccactcacggctgtctcttcacctacagagcgtctctggccgccccctggggcacaggaacatcatgtgactgatcccttagccaatggtgttggagagggcagtggataggggacacagggttcctgtaccccaagggccacacagttgggcccaacctgcccgcgtgacacccgctccctctcgctggaagtccctcaatttattgttttgcaacttttcatttttaataaaactattttctgaagaaaaaaaaaaaaaaaa
Translation: MESTQPRKLPRVPENLLKKRKKYLGLKAAEAKRALEEKRKTQPGKQIKFKRLETFVRNSHRKLRDDARLKRMKIYQKKIPGVATQSLAFVVRITKVDGVSNAVLDALKTLRLGKIFAGAFVKLTPSSLNLIRVVEPYVAWGFPNLKSIRELVLKRGHFRRDGRRVALTDNNVIEEQLGKFGIICLEDVIHELYTTGEHFPEVNRFLCPFRLSVSRHAAVNRKGYLSEVGDPGHRGSGINQLIRQLN
Donor tissue: tadpole