ORFeome > sag – XORFeome 2.0

sag – XORFeome 2.0

General Information

Species: Xenopus tropicalis S-antigen; retina and pineal gland (arrestin), mRNA (cDNA clone MGC:75721 IMAGE:5380905), complete cds
Gene Symbol: sag
Gene ID: 394670
ORF gb_acc: MG132922
ORF ID: 10288

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061277

Library Location

Plate ID: GDExt11003
Well Location: A09

EST Sequences

Clone: MGC:75721 IMAGE:5380905
Trimmed Sequence: ATGAGTGGTGATAAGAAATCCAGACATGTCATCTATAAGAAGACCTCCCGGGATAAGGCGGTGAGCGTGTACCTGGGCAAAAGGGATTATGTTGATCATGTGGAATCTGTGGACCCAGTAGATGGAGTTGTTCTAGTGGATCCCGACCTTCTTAAAGGAAAAAAAGTGTACGTCACCCTTACCTGTGCTTTCCGTTATGGCCAAGAGGACATTGATGTTATTGGCCTAACCTTCCGTAAAGACCTTTACTTTGCTCGGACTCAAATTTACCCACCAGTAGAGGACCCCAAGGCCTTGACCAAAGTTCAGGAGAGGCTGATGAAGAAATTAGGGAATAATGCATACCCATTTCTGCTGCAGTTCCCTGATTATCTGCCATGCTCTGTGTCTCTTCAGCCAGCTCCCACAGATGTGGGCAAGGCCTGCGGTGTGGATTTTGAAATTAAGGCATTTGCTACAAACAATTTAGAAGACAGAATTCACAAAAAGAACTCTGTTCGACTTATGATCCGCAAAATTCAATATGCGCCCGATCAGCCAGGGCCTAAACCCAGAGCGGAGACATCTTGGCAGTTCTTTATGTCAGACAAGCCTCTGCATCTGACGGCCTCTCTGCCTAAGGAGGTGTTTTATCATGGGGAGCCAATCTCTGTGTCTGTCAGCGTGACCAACAACTCCGACAAAACAGTGAAGAAAATATCTGCCTCAGTGGAACAAGTAAGTAATGTGGTGCTGTATTCCAGTGACTACTACATCAAGACGGTGGCTTTGGAGGATTCTCAGGACAAGGTACCTTCAAAGGCTTCCTATAATCACACCTTCACCCTACTGCCCCTGCTGGCATACAATCGGGAGAAGAGAGAAATTGCACTAGATGGGAAACTCAAACATGAGGACACCAACCTGGCTTCCAGCACTCTGCTTAAGGAAGGCATTGACCGCACTGTCATGGGAATCCTGGTCGACTACAAGATCAAAGTGACCCTCACTGTTTCTGGACTACTGGGAGACATGACCTCAAGTGAGGTTTCTACGGAGCTTCCATTCATTCTCATGCATCCAAACCCAGAGAGCGCCAAGGAAAGTGAGCAGGATGATGACATGGTGTTTGAAGAATTTGCCCGTGATCAACTCAAGGATGAACTGCAAGCTGAAGAAAAGGAGGAAGAGGAGGATGATGAGAAATAG
Full Trace Sequence: ggatatctcagtctgtaggagctgcgcagtatcaagcagagcaaaactagacctctcattgcagggttaccttactgcatcccaggaactctgctcttcatttgccaggtgttcagcagtcagtgatctgcgcgtcacattatgagtggtgataagaaatccagacatgtcatctataagaagacctcccgggataaggcggtgagcgtgtacctgggcaaaagggattatgttgatcatgtggaatctgtggacccagtagatggagttgttctagtggatcccgaccttcttaaaggaaaaaaagtgtacgtcacccttacctgtgctttccgttatggccaagaggacattgatgttattggcctaaccttccgtaaagacctttactttgctcggactcaaatttacccaccagtagaggaccccaaggccttgaccaaagttcaggagaggctgatgaagaaattagggaataatgcatacccatttctgctgcagttccctgattatctgccatgctctgtgtctcttcagccagctcccacagatgtgggcaaggcctgcggtgtggattttgaaattaaggcatttgctacaaacaatttagaagacagaattcacaaaaagaactctgttcgacttatgatccgcaaaattcaatatgcgcccgatcagccagggcctaaacccagagcggagacatcttggcagttctttatgtcagacaagcctctgcatctgacggcctctctgcctaaggaggtgttttatcatggggagccaatctctgtgtctgtcagcgtgaccaacaactccgacaaaacagtgaagaaaatatctgcctcagtggaacaagtaagtaatgtggtgctgtattccagtgactactacatcaagacggtggctttggaggattctcaggacaaggtaccttcaaaggcttcctataatcacaccttcaccctactgcccctgctggcatacaatcgggagaagagagaaattgcactagatgggaaactcaaacatgaggacaccaacctggcttccagcactctgcttaaggaaggcattgaccgcactgtcatgggaatcctggtcgactacaagatcaaagtgaccctcactgtttctggactactgggagacatgacctcaagtgaggtttctacggagcttccattcattctcatgcatccaaacccagagagcgccaaggaaagtgagcaggatgatgacatggtgtttgaagaatttgcccgtgatcaactcaaggatgaactgcaagctgaagaaaaggaggaagaggaggatgatgagaaataggatatgcaattccccatctctggctgtgacccagtatctagtaccctgtagcatgttgcatagcacagaccatgcattgatctaggtctcttcatgccctccttcttctatattaccttgacatgagcacaccccccacaatggagaaagctctttatgtagaaatgttagagtcaggattgattgattgaagaaaatggaacaaaacaagtcattgcttatctgattctgacccgatttagattgtaagattctgatcagtatcagcaaggactgtgtgtatttaatgcattcctactgtatgtactagcttacaacaacagcaatcaaagaagttgtaacacctttgatgtaacccaaataaaccaggtggcagtacgattctaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSGDKKSRHVIYKKTSRDKAVSVYLGKRDYVDHVESVDPVDGVVLVDPDLLKGKKVYVTLTCAFRYGQEDIDVIGLTFRKDLYFARTQIYPPVEDPKALTKVQERLMKKLGNNAYPFLLQFPDYLPCSVSLQPAPTDVGKACGVDFEIKAFATNNLEDRIHKKNSVRLMIRKIQYAPDQPGPKPRAETSWQFFMSDKPLHLTASLPKEVFYHGEPISVSVSVTNNSDKTVKKISASVEQVSNVVLYSSDYYIKTVALEDSQDKVPSKASYNHTFTLLPLLAYNREKREIALDGKLKHEDTNLASSTLLKEGIDRTVMGILVDYKIKVTLTVSGLLGDMTSSEVSTELPFILMHPNPESAKESEQDDDMVFEEFARDQLKDELQAEEKEEEEDDEK
Donor tissue: tadpole