ORFeome > sec11c – XORFeome 2.0

sec11c – XORFeome 2.0

General Information

Species: Xenopus tropicalis SEC11 homolog C, mRNA (cDNA clone MGC:89761 IMAGE:7027466), complete cds
Gene Symbol: sec11c
Gene ID: 448712
ORF gb_acc: MG133169
ORF ID: 10623

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077666

Library Location

Plate ID: GDExt11005
Well Location: C12

EST Sequences

Clone: MGC:89761 IMAGE:7027466
Trimmed Sequence: ATGGACCTGTTCGGGGACCTTCGGAGGATGAACAAGAGGCAGCTCTACTACCAGGTTCTGAATTTTGCCATGATAGTATCTTCAGCTCTAATGATATGGAAAGGCCTCATAGTGGTGACCGGAAGTGAGAGTCCAATAGTCGTCGTGCTGAGTGGCAGCATGGAGCCGGCTTTCCATCGGGGGGATCTGCTGTTCTTGACGAACTTCCAGGAAGACCCCATTCGCGCTGGTGAAATTGTAGTGTTTAAAGTGGAGGGCAGAGACATCCCGATCGTTCACAGGGTCATCAAAGTGCATGAAAAGGAGAATGGAGATATCAAATTCCTCACTAAAGGAGATAACAATGAAGTCGATGACCGAGGATTATATAAGGAGGGGCAAAATTGGCTGGAAAAGAAGGATGTTGTGGGGAGAGCGCGGGGGTTTTTGCCATATGTTGGTATGGTCACTATTGTCATGAATGATTACCCAAAATTTAAGTATGCGGTGTTGGCCATTATGGGCGCCTTTGTACTGTTAAAGCGTGAATCCTAA
Full Trace Sequence: ccccagaagggagggctggatgttggcagcgggcaggcacctcctattcccctgccagtgactgagctgccgcccagccccatgcccccggctgcccagcgcctggcatagacacagccaccatggacctgttcggggaccttcggaggatgaacaagaggcagctctactaccaggttctgaattttgccatgatagtatcttcagctctaatgatatggaaaggcctcatagtggtgaccggaagtgagagtccaatagtcgtcgtgctgagtggcagcatggagccggctttccatcggggggatctgctgttcttgacgaacttccaggaagaccccattcgcgctggtgaaattgtagtgtttaaagtggagggcagagacatcccgatcgttcacagggtcatcaaagtgcatgaaaaggagaatggagatatcaaattcctcactaaaggagataacaatgaagtcgatgaccgaggattatataaggaggggcaaaattggctggaaaagaaggatgttgtggggagagcgcgggggtttttgccatatgttggtatggtcactattgtcatgaatgattacccaaaatttaagtatgcggtgttggccattatgggcgcctttgtactgttaaagcgtgaatcctaacactggaaaaaggcataagaataataaaggcataatatatgactaaaaaaaaaaaaaaaa
Translation: MDLFGDLRRMNKRQLYYQVLNFAMIVSSALMIWKGLIVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNFQEDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKENGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIVMNDYPKFKYAVLAIMGAFVLLKRES
Donor tissue: