ORFeome > selt – XORFeome 2.0

selt – XORFeome 2.0

General Information

Species: Xenopus tropicalis selenoprotein T, mRNA (cDNA clone MGC:75917 IMAGE:5383677), complete cds
Gene Symbol: selt
Gene ID: 394463
ORF gb_acc: MG132995
ORF ID: 10378

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC059764

Library Location

Plate ID: GDExt11004
Well Location: A12

EST Sequences

Clone: MGC:75917 IMAGE:5383677
Trimmed Sequence: ATGCGGGTTATTAGCCAGCGGTACCCAGACATTCGTATAGAAGGAGAGAACTATCTTCCTCATCCCATTTATAGGAACATTGCATCTTTCTTGTCAGTCTTCAAGCTAGTATTAATAGGATTAATAATTGCTGGTAAAGATCCATTTGCGTTCTTCGGCATGCAAGCTCCAAGTGTTTGGCAGTGGGGACAAGAAAACAAGGTTTATGCTTGCATGATGGTTTTTTTTGTAAGCAACATGATTGAGAACCAGTGCATGTCCACAGGAGCCTTTGAGATCACTCTGAATGATGTACCCGTGTGGTCAAAGCTGGAGTCTGGGCACCTTCCATCCGTGCAGCAACTTGTCCAAATAATTGATAACGAAATGAAGTTAAATGTTCACATGGATGCAATTCCTCACCACCATCGCTCGTAG
Full Trace Sequence: cgaggagctcgggcccgttgtgtctactgctgctcggcggacttgttgccggtatcctgagcggggcctcagcggacggtaatgggctgccgagcaaaaagctaaagatgcagtatactgctgggccgctgctcaagttccagatctgtgtttcctgaggttatcggcgggtgtttgaggattacatgcgggttattagccagcggtacccagacattcgtatagaaggagagaactatcttcctcatcccatttataggaacattgcatctttcttgtcagtcttcaagctagtattaataggattaataattgctggtaaagatccatttgcgttcttcggcatgcaagctccaagtgtttggcagtggggacaagaaaacaaggtttatgcttgcatgatggttttttttgtaagcaacatgattgagaaccagtgcatgtccacaggagcctttgagatcactctgaatgatgtacccgtgtggtcaaagctggagtctgggcaccttccatccgtgcagcaacttgtccaaataattgataacgaaatgaagttaaatgttcacatggatgcaattcctcaccaccatcgctcgtagccacgtttcccagtaccacgtttatcttacatgaagcgggcttttgcaatggtgccaacggggctggtattcatgaaggcttgcactgaaaacacttgctgttagtgtaggctggaggcttctctgccgtctcgttgcgccgtttaaagtccccagtgcaagatactcatggtgctgctgctgtctcctggcattctacagagtgcaataacttcctgggtagcaagaagcatcttttatttaaagccattatttccagggctccatagttcatataatgctggcattacaacattttgttgttttataatcctgatttacagtgttgcaatagttcaagcctaattttcctcctaggacatttgtcctttttgagatctaatttttataagaatttcttctttttatagttttgaaatgctgttgtaacaaatatctccagtaatcctttacggtttccactttgtttccttaaagattatattgcagattatgaaaataagttattctaaattatgagcagacctgtaggcagataatggcatttagtggtggatacacactgaaacagattctagagtttttaactgagcctttatacttgtcctctttgcagaaaatgcagattaagttaaataaactgatcatgaaataaaacgtcactaaaaaaaaaaaaaaaaaaa
Translation: MRVISQRYPDIRIEGENYLPHPIYRNIASFLSVFKLVLIGLIIAGKDPFAFFGMQAPSVWQWGQENKVYACMMVFFVSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSVQQLVQIIDNEMKLNVHMDAIPHHHRS
Donor tissue: neurula