ORFeome > serp1 – XORFeome 2.0

serp1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis stress-associated endoplasmic reticulum protein 1, mRNA (cDNA clone MGC:75578 IMAGE:5379114), complete cds
Gene Symbol: serp1
Gene ID: 394685
ORF gb_acc: MG132772
ORF ID: 10084

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062484

Library Location

Plate ID: GDExt11002
Well Location: A02

EST Sequences

Clone: MGC:75578 IMAGE:5379114
Trimmed Sequence: ATGGTAGCCAAACAGAGAATCCGCATGGCCAATGAGAAGCACAGCAAGAACATCACACAGAGAGGCAACGTGGCCAAGTCATCGAGAAATGTGACGGAGGAGAAATCTGCAGTGGGACCATGGTTACTGGCGCTATTTATCTTCGTGGTCTGTGGATCCGCTATTTTCCAGATTATTCAGAGCATCAGGATGGGCATGTAA
Full Trace Sequence: gttgtgggcgtagcttgtggaattgcatacgctggcagctcggcaagtcggtactcagtgctcacacacccaacaaggcgaacgtagtgcttgtgggtatccttaccagcccaccgtttctttactctccctttatagtgtgcccagcctagccatggtagccaaacagagaatccgcatggccaatgagaagcacagcaagaacatcacacagagaggcaacgtggccaagtcatcgagaaatgtgacggaggagaaatctgcagtgggaccatggttactggcgctatttatcttcgtggtctgtggatccgctattttccagattattcagagcatcaggatgggcatgtaaagaagatctccccccccctctccctatgttgctattcacctgtgaagtataaacgaactctaatattttgatctattgaccaggacaaaggaaagataacggatttcacataactgcctgttccagaatgacagtttaatacaactctcatctgagtcattccaaattattccaccaaagtcattccaagttttctaatccataccacagtgccttcgcaaggcaccgtatgcagaaaagcaataaagcagaaagcctgcagttgtggagctactttattgagtgaaatgtcagttttttttctttgtgaaacaattttttgcaatgtagatacatagactaaatagctattttgttgcagctatttgtgtttaaatgttgtaccttttttaatgtataaaattggttacttttttctaatttaaaaatcaaaagctggaatactgattcttagataattggaacattctgtactatgctgcgtgaaaattgtctgtaaggtttgccctgtttccagatgctgctctgcattttttttaggtaattccctaaggacctagcatagagtccctgagcaacacttgctgtgtaaatggagagaaaacaaaaaagccacatttctgtaaacaaacaaaattgaacctgaccgtgaatcagctttatctacctctcccctgcattaatcgagtgtgatgctatagcaacgatcaatcagccaaacgcagcggagagatcttatgctaaccaatctggtttttggcattcaggtgctggcctgggtttactgtagaccccactggcgggtaacaagctgtcatttttcttaaatcatctgggaaaaggccactgctgcttggaggaataaaatactgtggacatactgggggtcttaaacttggtgcattacagctagttttgtgtgcaagtccaagtcagataatcttcttgcctttaatgatcattttctgccctctgtttttttttttttttttttctcttgtacaaatgaaggtttgtggcatgacttaagtgcgtaagagaccgtaaaggtattgctagcagctgatcaaaagaagtgttcttttgatgcatttttaaaataaaataaaattttacaaaaatgcaaaaaaaaaaaaaaaaaaaa
Translation: MVAKQRIRMANEKHSKNITQRGNVAKSSRNVTEEKSAVGPWLLALFIFVVCGSAIFQIIQSIRMGM
Donor tissue: tailbud