ORFeome > sfrs3 – XORFeome 2.0

sfrs3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis splicing factor, arginine serine-rich 3, mRNA (cDNA clone MGC:89287 IMAGE:6978611), complete cds
Gene Symbol: sfrs3
Gene ID: 448605
ORF gb_acc: MG133815
ORF ID: 11389

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076942

Library Location

Plate ID: GDExt11013
Well Location: H03

EST Sequences

Clone: MGC:89287 IMAGE:6978611
Trimmed Sequence: ATGCATCGTGACTCCTGTCCCTTAGACTGTAAAGTCTATGTTGGTAATCTTGGAAACAATGGCAACAAGACAGAATTAGAAAGAGCTTTTGGCTATTACGGACCTCTGCGCAGTGTGTGGGTTGCAAGGAATCCTCCAGGGTTTGCTTTTGTAGAATTTGAAGATCCCCGTGATGCTGCAGATGCTGTTAGAGAGCTGGATGGAAGGACGCTATGTGGGTGCCGAGTTAGGGTCGAATTATCCAATGGTGAGAAAAGAAGCAGAAACAGAGGACCTCCCCCTTCATGGAACAGACGGCCCCGGGATGACTATCGTAGAAGAAGTCCACCACCAAGACGCAGATCACCAAGGAGGAGAAGCTTTTCTCGTAGCCGTAGCAGGTCTCTTTCTAGAGATCGGAGGAGAGAAAGATCATTGTCCAGGGAAAGAAATCATAAGCCATCTCGCTCTTTTTCTCGATCAAGAAGCCGTTCTAGGTCCAATGAGCGAAAGTGA
Full Trace Sequence: ccaagagccggagagaagcttctgcgggacaccaatattctccaaactgtatcaagtctccgtcccctccactattgccatgcatcgtgactcctgtcccttagactgtaaagtctatgttggtaatcttggaaacaatggcaacaagacagaattagaaagagcttttggctattacggacctctgcgcagtgtgtgggttgcaaggaatcctccagggtttgcttttgtagaatttgaagatccccgtgatgctgcagatgctgttagagagctggatggaaggacgctatgtgggtgccgagttagggtcgaattatccaatggtgagaaaagaagcagaaacagaggacctcccccttcatggaacagacggccccgggatgactatcgtagaagaagtccaccaccaagacgcagatcaccaaggaggagaagcttttctcgtagccgtagcaggtctctttctagagatcggaggagagaaagatcattgtccagggaaagaaatcataagccatctcgctctttttctcgatcaagaagccgttctaggtccaatgagcgaaagtgaagcagctaccttcagcagtgtacagaaaaatacaattgaaaagggttttctgtttttgaaatgtcctacactttttaagattttttttttatttgctttgtactgtaacttgtaacaagtgatgaaaaaatgtgattctgtatatggttctaagcagataaagtcaaataataaacctgtttactttatactgttaaaaaggaaaatatttttttcaataacccccctctacaattttacctgggaagtataatatggcagttgcatagaactaaaagaaaatgaactttgcatgtgaccaaaccattaatttgtttggaaacttaatacgagtcttcacaaagggtgaaaattgtccactttattgtaatatcagaacaaaattgaatgaaacactaaaatgttgcactctgttcccgtattactttaaattagacaaattgactaatgcatttttacgaagtactgttccagatgtgtgggcctaacaggggaatctcagagggtctgtcacactgtttttattgtaaccgtatttgtaagccagcttctattcagtttttcaaagctttctatgcaagttgccagggtaatgttatttaattgtgcagatttcactgttccactacattttcccctcatgctgtaaacggcactgctttaccatttgtagaaatccttttttttagaaaaacgttttagtgcaccttacatgtgtcttgatgttcttgtgtagagtcttgcagtatacagcaatgatgtaaagttgtaaatgtgtggttgttgcgatttttctcagatcttttaaaccatgtgacttctggatttttttttttttcttggggattaaagtttttggttaaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWNRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
Donor tissue: tailbud