ORFeome > slc25a17 – XORFeome 2.0

slc25a17 – XORFeome 2.0

General Information

Species: Xenopus tropicalis solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17, mRNA (cDNA clone MGC:69279 IMAGE:5308404), complete cds
Gene Symbol: slc25a17
Gene ID: 448001
ORF gb_acc: MG133242
ORF ID: 10720

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074516

Library Location

Plate ID: GDExt11006
Well Location: E10

EST Sequences

Clone: MGC:69279 IMAGE:5308404
Trimmed Sequence: ATGGGGGGTTTGGAGTCTGCTCTGTTGTCGGTGTTCACATACGAGAGTTTGGTCCATGCAGTATCCGGAGCGGTGGGCAGTGTGGCTGCAATGACTCTATTCTATCCCCTGGACACAGCACGGCTCCGGCTGCAAGTGGATGACAATAGGAAGTCCCGTTCCACCCCGGCCGTCCTGCTAGAGATCATGCGCGAGGAGGGAGTACTGGCTCCGTACCGAGGTTGGTTCCCAGTCATCTCCAGTCTCTGCTGCTCCAACTTTGTTTATTTCTACACATTTAGCAGCTTGAAGGCGCTGTCGGTAAAAGGTAGCGTTCCAACCACGGGGAAGGATCTTACCATCGGCTTCATTGCTGGGGTTGTAAACGTGCTGATAACAACACCGCTCTGGGTGGTGAATACAAGGCTGAAACTGCAGGGGGCCAAGTTCCGCAATGATGATATTGTCCCAACAACGTATACAGGAATATTTGATGCCTTTCAAAGGATCCTGCGGGAGGAGGGTGTCATGGCTCTCTGGAACGGCACCTTTCCTTCCCTTCTGCTAGTCTTTAACCCAGCCATCCAATTCATGTTCTATGAAGCACTAAAGCGCCAGCTCCTGAAAGGGCAGCCAGAGCTGACAGCGATGGAGGTGTTTGTGATTGGTGCTATTGCGAAGGCCATTGCCACAGCTTTGACGTACCCAATGCAGACTGTCCAGTCAGTATTGAGGTTCGGACAGGAAAAGCTAAATCCAGAGAAGCGGGCGCTAGGAAGTTTGCGCAGTGTCCTCTATCTCCTTCAGCAAAGAGTCAAGCGATGGGGAATTCTGGGCCTATACAAAGGACTGGAAGCAAAGCTTTTACAGACTGTGCTAACTGCTGCACTCATGTTCCTGGTGTATGAGAAACTGACCAGCCTCACATTCAGGATTATGGGCCTAAAGGGCTGA
Full Trace Sequence: cgcggaagtgctgtgacacccggatagggagtgactagtagcaggtaatattaaggctgcaattacgatgctaaagcaagaagagatacagaagggttcggagatggggggtttggagtctgctctgttgtcggtgttcacatacgagagtttggtccatgcagtatccggagcggtgggcagtgtggctgcaatgactctattctatcccctggacacagcacggctccggctgcaagtggatgacaataggaagtcccgttccaccccggccgtcctgctagagatcatgcgcgaggagggagtactggctccgtaccgaggttggttcccagtcatctccagtctctgctgctccaactttgtttatttctacacatttagcagcttgaaggcgctgtcggtaaaaggtagcgttccaaccacggggaaggatcttaccatcggcttcattgctggggttgtaaacgtgctgataacaacaccgctctgggtggtgaatacaaggctgaaactgcagggggccaagttccgcaatgatgatattgtcccaacaacgtatacaggaatatttgatgcctttcaaaggatcctgcgggaggagggtgtcatggctctctggaacggcacctttccttcccttctgctagtctttaacccagccatccaattcatgttctatgaagcactaaagcgccagctcctgaaagggcagccagagctgacagcgatggaggtgtttgtgattggtgctattgcgaaggccattgccacagctttgacgtacccaatgcagactgtccagtcagtattgaggttcggacaggaaaagctaaatccagagaagcgggcgctaggaagtttgcgcagtgtcctctatctccttcagcaaagagtcaagcgatggggaattctgggcctatacaaaggactggaagcaaagcttttacagactgtgctaactgctgcactcatgttcctggtgtatgagaaactgaccagcctcacattcaggattatgggcctaaagggctgatccagaaggtcctgtgggtgcaaagactgtgctcctgtttgtaacgggatacatgggtttccctaaactgggctcctgtggcactaaggacctgtatatgaagtctcatcgtcttcccaaaaaaatgccaaaaacatcctatttaatgacagtaatgcaatgtttctctgccagcactgaacttggctgcctgatgttgcgctaatgtatttgtgacactacagtataaagatgcacaagttctgatgcagttctgaaggggcctgcgtaatatgtgcaagcaatgtccttttaaatccatgcagaataaaccatttagctattgtatggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGGLESALLSVFTYESLVHAVSGAVGSVAAMTLFYPLDTARLRLQVDDNRKSRSTPAVLLEIMREEGVLAPYRGWFPVISSLCCSNFVYFYTFSSLKALSVKGSVPTTGKDLTIGFIAGVVNVLITTPLWVVNTRLKLQGAKFRNDDIVPTTYTGIFDAFQRILREEGVMALWNGTFPSLLLVFNPAIQFMFYEALKRQLLKGQPELTAMEVFVIGAIAKAIATALTYPMQTVQSVLRFGQEKLNPEKRALGSLRSVLYLLQQRVKRWGILGLYKGLEAKLLQTVLTAALMFLVYEKLTSLTFRIMGLKG
Donor tissue: gastrula