ORFeome > sncb – XORFeome 2.0

sncb – XORFeome 2.0

General Information

Species: Xenopus tropicalis synuclein, beta, mRNA (cDNA clone MGC:75784 IMAGE:5381977), complete cds
Gene Symbol: sncb
Gene ID: 394467
ORF gb_acc: MG132911
ORF ID: 10276

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059756

Library Location

Plate ID: GDExt11003
Well Location: H08

EST Sequences

Clone: MGC:75784 IMAGE:5381977
Trimmed Sequence: ATGGATGTGCTTATGAAAGGCTTGTCCAAAGCAAAGGAAGGTGTGGTGGCTGCAGCCGAAAAGACTAAGCAAGGGGTAGCGGAGGCTGCAGAGAAAACCAAGGAAGGTGTCCTATATGTGGGAAGCAAAACCCGAGATGGAGTGGTGCAAGGAGTGGCTTCAGTGGCTGAAAAGACCAAAGAGCAGGCATCTCAGCTTGGGGGAGCCGTCATGTCTGGGGCTGGCAACATTGCTGCAGCTACTGGACTGGTGAAGAAGGATGAGTTCCCTACAGACATCAAGCCTGAAGAGGAGGCCCAGGAAGCCTTGGAAGAACCTGCAGCTGAGCCTCTCCTGGAACCTGAAGGAGAGAACTATGAAGAGGCCCCACAGGACGATTACCAGGAATATGAACCTGAAGCATAA
Full Trace Sequence: gattttcctgtgaagctcaggcagcttattttgcacaggaagctgtagctgaaaaaagagaggtcttggaagactgcaacagatcagaatggatgtgcttatgaaaggcttgtccaaagcaaaggaaggtgtggtggctgcagccgaaaagactaagcaaggggtagcggaggctgcagagaaaaccaaggaaggtgtcctatatgtgggaagcaaaacccgagatggagtggtgcaaggagtggcttcagtggctgaaaagaccaaagagcaggcatctcagcttgggggagccgtcatgtctggggctggcaacattgctgcagctactggactggtgaagaaggatgagttccctacagacatcaagcctgaagaggaggcccaggaagccttggaagaacctgcagctgagcctctcctggaacctgaaggagagaactatgaagaggccccacaggacgattaccaggaatatgaacctgaagcataacaacccaatatttcgggcccctccaccagcaacatcagcacaaagatagctataatgaaaaaaaaagatacaaataaagtttccctttcctaagcccccctttcaaaagatggatgaagcccacctcccttttctcctaagaagtgacttcttccttcagttcacctgcagagaacctcatgtgaagtgattttatgtatggtaacccttagcgttgagtcatagtccaagcaaaaatggatgtttaaaacaaagaaaaaaagaatcccttgataatgtatgaaaatcatgaatgcattgttactgtctttgcagtccttttgcccccaaggaattatttctgtttccctcccagagaataattgttgggggttcggtgaattttgtgtctcagattaattttgtaaactgtttttgtttttattttttgtttagatgtaatagctgactctgtgccaggggggcctgcaactccctgcaaccgacccagctaatactgcagcgtgtctacctacataaaataagcatgttttatctttttatatacatatggtgcacaaacaccaccaaaaaaaaaagacttttccgtttaactactcgtttgcccaaagtgggcattcgtgaagtttaaaggaaagccaaaaaaaaatttagctgtggatgactgacctttgacatagttaaatcagtgttataatgtgaaagttctctcttttttcgctgttgttttttttatacatatatacatatctacaaatatatatctggtttaacttatttgtgaccgttctgtaaagcggagagaaatctgtgagaatccatacagaatcttttgaatgttcttgtgttccaaataattttgcaaaatgaataaaaaaagattacccaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDVLMKGLSKAKEGVVAAAEKTKQGVAEAAEKTKEGVLYVGSKTRDGVVQGVASVAEKTKEQASQLGGAVMSGAGNIAAATGLVKKDEFPTDIKPEEEAQEALEEPAAEPLLEPEGENYEEAPQDDYQEYEPEA
Donor tissue: tadpole