ORFeome > snurf – XORFeome 2.0

snurf – XORFeome 2.0

General Information

Species: Xenopus tropicalis SNRPN upstream reading frame, mRNA (cDNA clone MGC:79763 IMAGE:6984715), complete cds
Gene Symbol: snurf
Gene ID: 407857
ORF gb_acc: MG133715
ORF ID: 11279

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076700

Library Location

Plate ID: GDExt11013
Well Location: H01

EST Sequences

Clone: MGC:79763 IMAGE:6984715
Trimmed Sequence: ATGACGGTGGGAAAAAGCAGCAAAATGCTGCAGCACATTGACTACAGAATGCGCTGTATCCTGCAAGATGGCCGGATCTTTATTGGAACATTCAAGGCATTTGACAAACACATGAATCTCATCTTATGCGACTGTGATGAGTTTAGAAAGATTAAGCCAAAGAACTCAAAACAGCCAGAACGAGAAGAAAAGAGAGTACTTGGTCTGGTGTTGCTTCGAGGGGAGAACTTGGTGTCAATGACTGTTGAAGGCCCACCTCCCAAAGATACTGGCATTGCCAGGGTTCCATTGGCAGGAGCTGCAGGAGGACCTGGAGTAGGAAGGGCAGCTGGCAGAGGTGTACCTGCTGGCGCACCTATGCCACAGGCTCCTGCTGGACTGGCAGGACCAGTACGTGGTGTTGGAGGACCTTCTCAGCAGGTTATGACCCCCCAGGGTCGTGGTAATGTGGCAGCAGCTGCTGCAGCTGCTACAGCAAGCATTGCTGGAGCTCCAACACCGTATGCAGCAGGTCGTGGCGGACCACCCCCACCAATGGGCAGAGGAGCACCTCCGCCAGGCATGATGGGACCACCCCCTGGTATGAGACCACCAATGGGTCCACCAATGGGAATGCCTCCAGGCAGAGGAGGACCTATGGGAATGCCACCTCCAGGGATGAGACCACCTCCACCCGGACCTCCACCACCTGGAATGCGACCCACTCGGCCATAA
Full Trace Sequence: gttagacttcctctataagaggctgctgtaggagtgaggctccttggcgcaattttttttcttccctttgtcggccgtgcatcggcggaatcctcggtgcaatcatgacggtgggaaaaagcagcaaaatgctgcagcacattgactacagaatgcgctgtatcctgcaagatggccggatctttattggaacattcaaggcatttgacaaacacatgaatctcatcttatgcgactgtgatgagtttagaaagattaagccaaagaactcaaaacagccagaacgagaagaaaagagagtacttggtctggtgttgcttcgaggggagaacttggtgtcaatgactgttgaaggcccacctcccaaagatactggcattgccagggttccattggcaggagctgcaggaggacctggagtaggaagggcagctggcagaggtgtacctgctggcgcacctatgccacaggctcctgctggactggcaggaccagtacgtggtgttggaggaccttctcagcaggttatgaccccccagggtcgtggtaatgtggcagcagctgctgcagctgctacagcaagcattgctggagctccaacaccgtatgcagcaggtcgtggcggaccacccccaccaatgggcagaggagcacctccgccaggcatgatgggaccaccccctggtatgagaccaccaatgggtccaccaatgggaatgcctccaggcagaggaggacctatgggaatgccacctccagggatgagaccacctccacccggacctccaccacctggaatgcgacccactcggccataaaacctcaaggcacatcttgtgttcaactcctgacttttctgttgactcactggactgttctggttcttgtttgttttatattgtaaatgaagcagtttttaaataaacaccatttttgatgtaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGAPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGNVAAAAAAATASIAGAPTPYAAGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGMPPGRGGPMGMPPPGMRPPPPGPPPPGMRPTRP
Donor tissue: tadpole