ORFeome > socs3 – XORFeome 2.0

socs3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis suppressor of cytokine signaling 3, mRNA (cDNA clone MGC:75749 IMAGE:5381461), complete cds
Gene Symbol: socs3
Gene ID: 394588
ORF gb_acc: MG132923
ORF ID: 10289

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061288

Library Location

Plate ID: GDExt11003
Well Location: G09

EST Sequences

Clone: MGC:75749 IMAGE:5381461
Trimmed Sequence: ATGGTCACACTTCGCTGGAGTTGCTTTCATCGCTGCCCTTGTCCATCATCCATCTTTGCAGCCATGAATCGACAGGCTGCCCAGCTGTCTTACCACTATAAGTCGTTCTGTGGGGACTATGAAAGGGTCGAGACTGCTCTTGAAAGATTGGAAGCTAGCGGCTACTACTGGAGTACCTTGTCCGGCACAGAAGCTAAAAAGCTTCTATCTGACCAGCCTGTCGGTTCCTTCCTTATTCGTGACTCTTCAGATCATCACCATCTTTTTACCCTCAGCCTTCGCACATCTGCCGGTATCACAAACCTACGCATTAAGCTTGAGGGTCCTTCCTTCTATCTTGAGACAGTGGCCGGGGCAGAGAGTCCTCACACATTTCCTTGTGTGGTCAAATTGGTGGAGCATTATATGCGTCTTACAGCTGCAGGAGAATCTGACTCCAACCTGTGCTACATTGAAGGGAACGACCAACCTGTTCCTCTCATGCTTACGCAGCCGCTGAATTGCAAAGTGGTTTCCCTTCAGTATTTATGTAAACGGACAGTGGTAGCGAACATGCCAGCTGAAGCTTCTTCTTCAGGAGAGAACATGGAGGAGCTACCGGTGTCTAAAATGCTTAGAAATGCCTTTAGAAACTAG
Full Trace Sequence: gtttgtgaggaggctaaggtgagttaggaagatggatagaggtgagccatgagtatcatgttatgacaacctgtctggctcatccttctcacaggacacagtggccaaggtcgattagcctgacgatggtcacacttcgctggagttgctttcatcgctgcccttgtccatcatccatctttgcagccatgaatcgacaggctgcccagctgtcttaccactataagtcgttctgtggggactatgaaagggtcgagactgctcttgaaagattggaagctagcggctactactggagtaccttgtccggcacagaagctaaaaagcttctatctgaccagcctgtcggttccttccttattcgtgactcttcagatcatcaccatctttttaccctcagccttcgcacatctgccggtatcacaaacctacgcattaagcttgagggtccttccttctatcttgagacagtggccggggcagagagtcctcacacatttccttgtgtggtcaaattggtggagcattatatgcgtcttacagctgcaggagaatctgactccaacctgtgctacattgaagggaacgaccaacctgttcctctcatgcttacgcagccgctgaattgcaaagtggtttcccttcagtatttatgtaaacggacagtggtagcgaacatgccagctgaagcttcttcttcaggagagaacatggaggagctaccggtgtctaaaatgcttagaaatgcctttagaaactagatagacccatgcattttttttaaaagatggagcattaaggaacttctagatcagaagatactgatccatttgttatccaatcacaatttaaaatgaaatgaagtagttttttttcttctgaacaggggatactcagaggaggacaaaaacctgtataatttcctgcctgaacctcagaatactgaacagacagccaaaatagctttacaaaaaaaaaaaaaaaaaaa
Translation: MVTLRWSCFHRCPCPSSIFAAMNRQAAQLSYHYKSFCGDYERVETALERLEASGYYWSTLSGTEAKKLLSDQPVGSFLIRDSSDHHHLFTLSLRTSAGITNLRIKLEGPSFYLETVAGAESPHTFPCVVKLVEHYMRLTAAGESDSNLCYIEGNDQPVPLMLTQPLNCKVVSLQYLCKRTVVANMPAEASSSGENMEELPVSKMLRNAFRN
Donor tissue: tadpole