ORFeome > socs3 – XORFeome 2.0

socs3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis suppressor of cytokine signaling 3, mRNA (cDNA clone MGC:88877 IMAGE:6998184), complete cds
Gene Symbol: socs3
Gene ID: 448204
ORF gb_acc: MG134070
ORF ID: 11690

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075262

Library Location

Plate ID: GDExt11016
Well Location: B04

EST Sequences

Clone: MGC:88877 IMAGE:6998184
Trimmed Sequence: ATGGTCACGCAGAGCAAGTTCCCGAGCATGAGCCGGGCACTGGACTCTAGTCTACGACTTAAGACCTTCTCTTCCCGCAGCGAGTACAACCTTGTGCTGACTGCAGTGCGCAAACTCCAAGAGAGTGGTTTTTACTGGAGCACTGTAACAGGCAGCCAGGCAAACTTACTACTGAGCACAGAACCAGCGGGAACATTTCTTATCCGTGACAGCTCTGATCGGCGACACTTTTTCACCCTCAGTGTCAAAACTGAGTCGGGTACCAAGAACCTTCGCATTCAGTGTGAGCCTTGTGGATTCTCTTTGCAGACTGACCCACGCAGTGCCCAGCCAGTACCACGTTTTGACTGTGTCTTAAAGTTGCTGTGCCATTATATGCCAGCCAAGGACTCAGGCAGTGGCTCCAAACGGGCATATTACATTTATTCTGGAGGGGAGCGGGTCCCTTTGCTTCTGTCACGGCCACTATCAACCAGTGTGTCTTCTCTGCAGCACTTATGTAGGAAGGCTGTAAATGGTACCATAGAAGGGGGTGAGGGGCGAGAGCAGCTGCCGTTGCCCATAAAAGACTTTCTGCAGGAATATGACTCCCCTGTGTAG
Full Trace Sequence: cttgtgagacagcaatagtatacactttttaacacagcttggactatcccaggactatcacaggggtctgaaagtgaccaaagcagctgggacatattcgttatctgcctttgaatatctttattgtgaatctgctccctcaatagccgtgggaactgcctatttcattcagtttattgctgtgcagtagaactgaacctgttcctttaataacacacgtcaaaggactcaaactccattataaaaactggctccaaccgtcatggtcacgcagagcaagttcccgagcatgagccgggcactggactctagtctacgacttaagaccttctcttcccgcagcgagtacaaccttgtgctgactgcagtgcgcaaactccaagagagtggtttttactggagcactgtaacaggcagccaggcaaacttactactgagcacagaaccagcgggaacatttcttatccgtgacagctctgatcggcgacactttttcaccctcagtgtcaaaactgagtcgggtaccaagaaccttcgcattcagtgtgagccttgtggattctctttgcagactgacccacgcagtgcccagccagtaccacgttttgactgtgtcttaaagttgctgtgccattatatgccagccaaggactcaggcagtggctccaaacgggcatattacatttattctggaggggagcgggtccctttgcttctgtcacggccactatcaaccagtgtgtcttctctgcagcacttatgtaggaaggctgtaaatggtaccatagaagggggtgaggggcgagagcagctgccgttgcccataaaagactttctgcaggaatatgactcccctgtgtagccaaagaaaaggatcaacaggaattaaaactcaaatgagtagaatgcatggttgccacacagagtgcccagtgcctaggaagaagagagcacagagaacagaggcacagagcacccatggagatcagtaaagcaaggcaataaaaagattatgacaaagtggacctaaagaaacaacatttgcctgcaaaggacattttgttcagtattaaaaagcctgagacaaaaaaagtgcttaatacttaagtgatgaacacaaaatgccaagtactgttttagagactgagcatctgcaataagaactgtctaaataaacacagtatgtgaccatcagacacttcccctctacctctcaaatgaccctgctcgccgggcgcagagggaagtggtggaaaggatggtggctgctctaaggaccttggttctggttccctccccggcaaacactaccagaacccagggcctgttttgcactgaaagttggaggatgtatttattacaatgtcacctacacagccttaatcagatcttctggagggcagtatctgtcacactgcagggcattaccagtacatgtagcgctatacagatggcagcttccatgtattatctccaggagagactgaactcatgcacaagcattgggccgatatacacttgcctgcacattacatttttatcggcagaaatacaaaaatacttgcaccctggacaatgaatggtgacgtcaccatgaagttttgttttttttttgcacaagaaacgtgtgccattgctgggtgagaccgcagagggcactgtacatgatcctaacctcaatcatgtttacatgacgaccaccaataatgggcaacatccccaggacaaaatttgcacatatttatatttaacacaaagaaatccatttcagtaacttataataaaaaataatttttgtaatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVTQSKFPSMSRALDSSLRLKTFSSRSEYNLVLTAVRKLQESGFYWSTVTGSQANLLLSTEPAGTFLIRDSSDRRHFFTLSVKTESGTKNLRIQCEPCGFSLQTDPRSAQPVPRFDCVLKLLCHYMPAKDSGSGSKRAYYIYSGGERVPLLLSRPLSTSVSSLQHLCRKAVNGTIEGGEGREQLPLPIKDFLQEYDSPV
Donor tissue: