ORFeome > sparc – XORFeome 2.0

sparc – XORFeome 2.0

General Information

Species: Xenopus tropicalis secreted protein, acidic, cysteine-rich (osteonectin), mRNA (cDNA clone MGC:79700 IMAGE:6981043), complete cds
Gene Symbol: sparc
Gene ID: 394973
ORF gb_acc: MG133681
ORF ID: 11236

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC079950

Library Location

Plate ID: GDExt11012
Well Location: E06

EST Sequences

Clone: MGC:79700 IMAGE:6981043
Trimmed Sequence: ATGAGGGTCTGGGTCTTCTTCGTCTTGTGCCTGGTTGGCAAAGCTCTAGCTGCCCCTCAACAGGATGCTTTACCAGAAGAGGAAGAGGTGATAGAAGATGTTCCAACAGAGGAGACAGTGGGTGCTAATCCTGTGCAGGTTGAAGTCGGGGAGTTTGACGACGCAGTCAATGAGGAGGAGGAGGAAGAGCCATCTGAGAATCCATGCCTGAACCACCACTGCAAACATGGCAAAGTTTGTGAAGTAGATGAAAGCAACACCCCAATGTGTGTGTGCCAAGACCCATCTACCTGCCCCAGTAGTTTAGCCGAGTTTGAGAAGGTCTGTGGCACAGATAACAAGACCTATGAATCTTCCTGCCACTTCTTTGCAACCAAATGCACCCTGGAAGGGACCAAGAAGGGCCATAAACTGCATCTTGATTATATTGGACCATGCAAATACATTGCTCCCTGTTTGGACAACGAGCTGAGCGAATTTCCCCTGCGTATGCGTGACTGGCTCAAGAATGTCCTGGTCAGTCTGTATGAAAGAGATGAGAACAACAATTTACTGAATGAAAAGCAGAAACTGAGGGTGAAGAAGATCCATGAGAATGAGAAGCGCTTGGAAGCTGGAGACCACTCTATGGAACTGCTGGCACGTGACTTTGAGAAGAACTACAACATGTACATTTTCCCTGTACACTGGCAATTTGGCCAGCTGGACCAACACCCCATCGATGGGTACCTTTCCCACACTGAGCTGTCTCCCCTTCGCGCCCCGTTGATCCCCATGGAACACTGCACCACACGCTTTTTTGATGAGTGCGACACTGACAACGATAAATACATTGCCTTAGAAGAATGGGCCAAGTGCTTTGGAATCAAAGAACAGGACGTGGATAAGGATATGATTGTCTAA
Full Trace Sequence: ctaggagcctgaagctctctcctctgctccgaggtccgacttcagaatgagggtctgggtcttcttcgtcttgtgcctggttggcaaagctctagctgcccctcaacaggatgctttaccagaagaggaagaggtgatagaagatgttccaacagaggagacagtgggtgctaatcctgtgcaggttgaagtcggggagtttgacgacgcagtcaatgaggaggaggaggaagagccatctgagaatccatgcctgaaccaccactgcaaacatggcaaagtttgtgaagtagatgaaagcaacaccccaatgtgtgtgtgccaagacccatctacctgccccagtagtttagccgagtttgagaaggtctgtggcacagataacaagacctatgaatcttcctgccacttctttgcaaccaaatgcaccctggaagggaccaagaagggccataaactgcatcttgattatattggaccatgcaaatacattgctccctgtttggacaacgagctgagcgaatttcccctgcgtatgcgtgactggctcaagaatgtcctggtcagtctgtatgaaagagatgagaacaacaatttactgaatgaaaagcagaaactgagggtgaagaagatccatgagaatgagaagcgcttggaagctggagaccactctatggaactgctggcacgtgactttgagaagaactacaacatgtacattttccctgtacactggcaatttggccagctggaccaacaccccatcgatgggtacctttcccacactgagctgtctccccttcgcgccccgttgatccccatggaacactgcaccacacgcttttttgatgagtgcgacactgacaacgataaatacattgccttagaagaatgggccaagtgctttggaatcaaagaacaggacgtggataaggatatgattgtctaagcaacaccgatgactcctgtctgtgcatcttttatttgtgttgtattttattttgtatctcctcttttcaccctttagtttggaatatttgtctactggggttgggcagcaaaggtgctaacttagaaaacattattaacggtgctaaatcgaacaagtaataaaactcaatagcaagcggaggagatcaaagcgtcgtcaccactagctctgaattccagtgtctggccagttatgcttctcttttcctttcatagactgtccaactcctaatgccatcttcatcctaagtcttaacctattgttatatcttcctgaaaacacagtgttaaagcaggactttaaccccttcatctgctggagcagccctctagcaattaaggggttaacccctgactggatgcagggggtaggaggttgggggttttgtaacaaggaaagggtgggtatgggcttagtttttaaggggggtggtggtttagcctgacccctcttataaagcatttctgccagaatgtctctatattttatttagacgattcggcttacttttattgacatcactgcacgccattcaactcagagaataaacaatgaaaaatgctccttttgttatgtccctgcgcttatgccctgtgttacacgcttgccagtgtcaacatgtagagaaataaaatatttcataggtgcttctttaacaaaaaggaatcaccttgtacctgtaaaatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRVWVFFVLCLVGKALAAPQQDALPEEEEVIEDVPTEETVGANPVQVEVGEFDDAVNEEEEEEPSENPCLNHHCKHGKVCEVDESNTPMCVCQDPSTCPSSLAEFEKVCGTDNKTYESSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDNELSEFPLRMRDWLKNVLVSLYERDENNNLLNEKQKLRVKKIHENEKRLEAGDHSMELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELSPLRAPLIPMEHCTTRFFDECDTDNDKYIALEEWAKCFGIKEQDVDKDMIV
Donor tissue: tailbud