ORFeome > ss18 – XORFeome 2.0

ss18 – XORFeome 2.0

General Information

Species: Xenopus tropicalis synovial sarcoma translocation, Chromosome 18, mRNA (cDNA clone MGC:79487 IMAGE:6976678), complete cds
Gene Symbol: ss18
Gene ID: 780399
ORF gb_acc: MG133582
ORF ID: 11118

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080325

Library Location

Plate ID: GDExt11010
Well Location: B10

EST Sequences

Clone: MGC:79487 IMAGE:6976678
Trimmed Sequence: ATGTCTGTAGCTTTCGCGGCTCCCAGGCAGCGGGGGAAGGGGGAGATCACTCCTGCGGCCATTCAAAAGATGCTGGATGAAAATAACCATCTAATACAATGCATAATGGATTATCAGAACAAAGGAAAAACCTCAGAATGTTCCCAATATCAACAGATGCTGCATACAAACTTAGTATACTTGGCCACAATAGCAGATTCGAATCAGAATACCCAACCTTTATTGTCAGCACTTCCTACACAAAATATGCCTATGGGTCCAGCAGGGATGAATCAGAGTGGCCCTCCACAACCACCACGCGCTCACAACATGCCTTCAGAAGGGATGGTAGGAGGGGGTCCGTCTGCACCGCACATGCAGAACCAGATGAACGGCCAGATGCCTGGACCAAACCATATGCCTATGCAAGGTCCAGGACCTGGCCAACATAATATGCCAAACAGTTCCATGAACATGCCTTCTAACAACCATGGTTCCATGGGAGGCTATAACCATTCTGTGCCATCCTCGCAAAATATTCCAGCCCAGAATCAGATGAGCATGAGCCAAGGCCAGTCCATGGGCAACTATGGTCCTCGGCCGAATATGAACATCCAACCAAATCAAGCTCCTATGATCCACCAACAACCTCCCTCGCAGCAGTATAATATGCCTCAGGGAGGACAGCATTATCAGGGACAACAACCACCAATGGGCATAATGGGCCAAGTTAACCAAGGAAATCATATGATAGGACAAAGGCAAATTCCACCATACAGACCCCCTCAGCAAGGTCCACCCCAACAATACTCTGGTCAGGAAGAGTACTATGGAGAACAATATAGCCATGGTGCTCAAGGTACCCCAGAGGGCATTAATCAACAATACTATCCTGATGGAAATGCGCAATACAGCCAACAGCAAGAATCTTATCAAGGACCACAGCAGCAGCAAGGCTACCCACCTCAGCAACAGCAATACGCTGGTCAGCAAGCTTATCCTGGTCAGCAGCAAGGTTATGCACCTTCACAAAGTGGTCCTGGACCTCAGTACCCTAACTATCCGCAAGGACAAAGCCAGCAGTATGTGCAATACAGGCCTACACAACCAGGCCCTCCCCAGCCCCAACAGCAGAGGCCATATGGATATGATCAGGGTCAATATGGAAACTACCAACAATGA
Full Trace Sequence: cacttcgctccctttgttttctttagctcgtgtatcatgtctgtagctttcgcggctcccaggcagcgggggaagggggagatcactcctgcggccattcaaaagatgctggatgaaaataaccatctaatacaatgcataatggattatcagaacaaaggaaaaacctcagaatgttcccaatatcaacagatgctgcatacaaacttagtatacttggccacaatagcagattcgaatcagaatacccaacctttattgtcagcacttcctacacaaaatatgcctatgggtccagcagggatgaatcagagtggccctccacaaccaccacgcgctcacaacatgccttcagaagggatggtaggagggggtccgtctgcaccgcacatgcagaaccagatgaacggccagatgcctggaccaaaccatatgcctatgcaaggtccaggacctggccaacataatatgccaaacagttccatgaacatgccttctaacaaccatggttccatgggaggctataaccattctgtgccatcctcgcaaaatattccagcccagaatcagatgagcatgagccaaggccagtccatgggcaactatggtcctcggccgaatatgaacatccaaccaaatcaagctcctatgatccaccaacaacctccctcgcagcagtataatatgcctcagggaggacagcattatcagggacaacaaccaccaatgggcataatgggccaagttaaccaaggaaatcatatgataggacaaaggcaaattccaccatacagaccccctcagcaaggtccaccccaacaatactctggtcaggaagagtactatggagaacaatatagccatggtgctcaaggtaccccagagggcattaatcaacaatactatcctgatggaaatgcgcaatacagccaacagcaagaatcttatcaaggaccacagcagcagcaaggctacccacctcagcaacagcaatacgctggtcagcaagcttatcctggtcagcagcaaggttatgcaccttcacaaagtggtcctggacctcagtaccctaactatccgcaaggacaaagccagcagtatgtgcaatacaggcctacacaaccaggccctccccagccccaacagcagaggccatatggatatgatcagggtcaatatggaaactaccaacaatgaagagagtatgtatccctgtagtctgtctttgtagctgttgttttgcttcctccgaactgtggacattttgcctattttatctttactataaatttgggaaatccatctgaattaaaccaatgcgttttgcagtaaatgtgggtttatatttatagtcattcttttactgaggcatatacaattcctgtactctagatggcaatgttgcataaaaaacaaatccgcaaggcaccactgctgtcaatgacttctgaatcttacaggatgttggttactttttcttttgttgggactgcatagaatcggacaaaggcattctatcctgggttatatgcaaactggtactccggggaaggaccagtttaactggccatggatgaaggacaatttagccaaaaactcaaagaattcaatcttgtacaatgtaccgtaatattttgaatttgatgcagtttttctgtattgctaaaaataaatttattgtaaaatcattaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSVAFAAPRQRGKGEITPAAIQKMLDENNHLIQCIMDYQNKGKTSECSQYQQMLHTNLVYLATIADSNQNTQPLLSALPTQNMPMGPAGMNQSGPPQPPRAHNMPSEGMVGGGPSAPHMQNQMNGQMPGPNHMPMQGPGPGQHNMPNSSMNMPSNNHGSMGGYNHSVPSSQNIPAQNQMSMSQGQSMGNYGPRPNMNIQPNQAPMIHQQPPSQQYNMPQGGQHYQGQQPPMGIMGQVNQGNHMIGQRQIPPYRPPQQGPPQQYSGQEEYYGEQYSHGAQGTPEGINQQYYPDGNAQYSQQQESYQGPQQQQGYPPQQQQYAGQQAYPGQQQGYAPSQSGPGPQYPNYPQGQSQQYVQYRPTQPGPPQPQQQRPYGYDQGQYGNYQQ
Donor tissue: tailbud