ORFeome > ssbp3 – XORFeome 2.0

ssbp3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis single stranded DNA binding protein 3, mRNA (cDNA clone MGC:75859 IMAGE:5382824), complete cds
Gene Symbol: ssbp3
Gene ID: 394816
ORF gb_acc: MG133049
ORF ID: 10451

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063345

Library Location

Plate ID: GDExt11005
Well Location: G01

EST Sequences

Clone: MGC:75859 IMAGE:5382824
Trimmed Sequence: ATGTTCGCTAAAGGAAAAGGTTCAGCGGTGCCGTCAGACGGACAGGCCCGAGAAAAGCTGGCACTTTATGTCTATGAATACTTGCTTCATGTTGGGGCCCAGAAATCTGCACAGACATTCCTGTCTGAGATACGATGGGAGAAGAATATCACTTTGGGGGAACCTCCAGGCTTCTTACACTCCTGGTGGTGCGTATTCTGGGACTTGTACTGTGCTGCTCCTGAGAGGCGAGATACCTGTGAACATTCAAGTGAAGCAAAAGCTTTTCATGATTATAGTGCAGCAGCGGCTCCAAGTCCAGTGCTTGGGAACATTCCTCCAAGTGACGGAATGCCTGGAGGACCAATTCCACCAGGATTCTTCCAGCAGGGTCCTCCTGGGTCACAACCATCACCTCATTCACAGCCTCCTCCTCACAACCCCAACATGATGGGACCTCACAGTCAGCCTTTTATGTCACCTCGATATGCTGGTGGTCCAAGACCGCACATACGAATGGGTAATCAGCCTCCTGGAAGTGTGCCAGGATCTCAGCCTTTACTACCAAACTCCATGGATCCAACACGGCAAGGACACCCTGGAATGGGAGGTCCTATGCAAAGAATGAACCCTCCCAGATCAATGGGCCCTATGGGTCCTGGGCCTCAGTCTGATCCTTGGTTATCATTGCAGAATTATGGCAGTGGGATGAGACCTCCCCCCAATTCCTTAGGTCCTGGAATGAACATGGGTCCAGGATCAGGCAGGCCGTGGCCGAACCCAAACAGTGCCAATTCTATTCCCTACTCCTCTTCCTCACCTGGCACATATGTTGGTCCCCCTGGAAGTGGAGGTCCTCCAGGAACGCCCATAATGCCCAGCCCTGCAGAGTCAACAAATTCAAGTGACAACATCTATACAATGATAAATCCAGTTCCACCATCAGGAAATCGTTCAAACTTTCCAATGGGACCTGGCTCAGATGGCCCTATGGGAGGTATGGGTGGAATGGAGCCTCATCACATGAATGGATCATTAGGGTCAGGAGACATGGATGGACTTCCTAAGAACTCCCCAAACAACATAAGTGGCATTAGTAACCCTCCAGGGACACCAAGGGATGATGGCGAGTTAGGAGGGAACTTCCTTCATTCTTTCCAAAATGACAATTACTCTCCCAGCATGACAATGAGCGTGTGA
Full Trace Sequence: gacagacgctaagacactgctagagaaaggagccctcacactaggagagcgctacagaaagagacactgggagacttccacacagccagagatggggtcattcgaggcgtacagtatttctaagagacagacaacaggaagagacagatagacattacattgtacccggagcgccagtcagtgcctttagaccgtctgctctaccagagagtggcatctatcggtacactacggtaagctagcgatcctgccccgtaccggctactgttgggacactctccattgggaacgccacctcggaactaacagcctcacctccccgggctccgagtcaccaggagcgcccgtttctgcttctccccaccgaccgtggatcagctgaagcatgttcgctaaaggaaaaggttcagcggtgccgtcagacggacaggcccgagaaaagctggcactttatgtctatgaatacttgcttcatgttggggcccagaaatctgcacagacattcctgtctgagatacgatgggagaagaatatcactttgggggaacctccaggcttcttacactcctggtggtgcgtattctgggacttgtactgtgctgctcctgagaggcgagatacctgtgaacattcaagtgaagcaaaagcttttcatgattatagtgcagcagcggctccaagtccagtgcttgggaacattcctccaagtgacggaatgcctggaggaccaattccaccaggattcttccagcagggtcctcctgggtcacaaccatcacctcattcacagcctcctcctcacaaccccaacatgatgggacctcacagtcagccttttatgtcacctcgatatgctggtggtccaagaccgcacatacgaatgggtaatcagcctcctggaagtgtgccaggatctcagcctttactaccaaactccatggatccaacacggcaaggacaccctggaatgggaggtcctatgcaaagaatgaaccctcccagatcaatgggccctatgggtcctgggcctcagtctgatccttggttatcattgcagaattatggcagtgggatgagacctccccccaattccttaggtcctggaatgaacatgggtccaggatcaggcaggccgtggccgaacccaaacagtgccaattctattccctactcctcttcctcacctggcacatatgttggtccccctggaagtggaggtcctccaggaacgcccataatgcccagccctgcagagtcaacaaattcaagtgacaacatctatacaatgataaatccagttccaccatcaggaaatcgttcaaactttccaatgggacctggctcagatggccctatgggaggtatgggtggaatggagcctcatcacatgaatggatcattagggtcaggagacatggatggacttcctaagaactccccaaacaacataagtggcattagtaaccctccagggacaccaagggatgatggcgagttaggagggaacttccttcattctttccaaaatgacaattactctcccagcatgacaatgagcgtgtgacctcctgtatcttctcctagagacaatactcaactccgctgctgcttggaaggtcacagtgataaaggaagatgatgtgtctggatgtgcaagggttcctgggacagctccccctggtttggttttatgcaataaaaaggcaaaactttttattccatcaaacatggaggacaaaactcttgagacaagaaaattgctctgaggatttatatatgtacagattttttttcccatgtgcatcagaagaagcgtcaattaatggatctcattgctgtgtctccctttttttaaatctatgtctgtgacgtgatattcaaggaaaatagttgaaataggaaatttcatgtgtctttagccttagtttaatttttcaaacaaactgaagatttcagttgtccaggtccctccaaagaatcttttgtgcagttccgaacactcccccaagacaaaatcagttcaaaggtgtatttgttactgtgcagagactgttcagatctgtacatgcttctctctctttacctcatgaaaaaagacttgatattatggtgaaacacccaagactttggttttcctcctccttcccatgagtgcgattttactcagtaattccaaggcaaaaaggaagatgctctcaccagagaaacactgatttttgtttgttttttttgttttttaattttctttgagaagaaacactatcaagatttgaaggcctgaggtttagatggcaaacatgttttcagtggtagtgatgcagacttttgtaagctcctgtgaagaatgccctacattaaaagctgacaagtatatggaggaaaggacatggcagaacctcttgtttacagtccttcactgcttcccttccattttatgtcaccactgcctggtctgtgtttcctattgtaccattctcagcctggattatagtctgccaagagccaacatcatatctgtatcttatttgcttttctcattctgggtctacatgaaagattggtacctacatacatgttgttttggttcaatatttgtttaataaaagggatggtattctgcaccctgcccaggacatgcttgtgtgggatgttggctcagatgctgatcacaaattgtgatatgttatattttatcttttgttaaaagtaataacttctgattttgcctagttttgggcattattattgtgcattttttttttttttttttgtcaaacagctggaaggagggaaaaacagctcctctcaggactatctcatgggagaaactcattatgtatttgaaaagggatagttaaattattgtctcttgctataggacagcttggaatgaaatggttaatgttctccctccatgctggaaaaatttaataaacggaaatgaacactcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPSDGMPGGPIPPGFFQQGPPGSQPSPHSQPPPHNPNMMGPHSQPFMSPRYAGGPRPHIRMGNQPPGSVPGSQPLLPNSMDPTRQGHPGMGGPMQRMNPPRSMGPMGPGPQSDPWLSLQNYGSGMRPPPNSLGPGMNMGPGSGRPWPNPNSANSIPYSSSSPGTYVGPPGSGGPPGTPIMPSPAESTNSSDNIYTMINPVPPSGNRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDMDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV
Donor tissue: neurula