ORFeome > stk38l – XORFeome 2.0

stk38l – XORFeome 2.0

General Information

Species: Xenopus tropicalis serine/threonine kinase 38 like, mRNA (cDNA clone MGC:89416 IMAGE:6990020), complete cds
Gene Symbol: stk38l
Gene ID: 448427
ORF gb_acc: MG133869
ORF ID: 11452

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075525

Library Location

Plate ID: GDExt11014
Well Location: D06

EST Sequences

Clone: MGC:89416 IMAGE:6990020
Trimmed Sequence: ATGGCAATGACAGCGACGAACCCGACGTCTTGTCCAATGAGCAGCCACACCCGGGAGCGGGTCACCGTGGCCAAACTCACTCTGGAGACTTTCTATAGCAACCTGATCCTGCAGCACGAGGAGCGAGAGACCCGGCAGAAGAAGCTGGAGGTCGCCATGGAAGAGGAGGGCTTAGGAGACGACGAGAAAAAAATGCGCCGGTCGCAACACGCCCGGAAGGAAACTGAGTTCCTGCGCCTGAAGAGGACCCGGCTGGGCCTGGAAGACTTTGAGTCCTTGAAAGTCATCGGCCGAGGAGCCTTCGGAGAGGTCCGCCTTGTTCAGAAGAAGGACACCGGGCACATCTATGCCATGAAGATCCTACGCAAGGCTGACATGCTGGAGAAAGAACAGGTAGCGCATATCCGGGCGGAGCGGGACATCCTGGTGGAAGCGGATGGGGCCTGGGTGGTGAAGATGTTCTACAGCTTCCAGGATAAGAGGAACCTCTATCTGATCATGGAGTTTCTGCCCGGAGGGGACATGATGACTTTGCTGATGAAGAAGGACACGCTGACGGAGGAGGCGACGCAGTTTTATATCGCCGAGACTGTCCTGGCTATCGATGCCATTCACCAGCTCGGGTTCATCCACAGGGATATCAAGCCGGACAATCTGCTATTGGATGCAAAGGGTCACGTCAAGCTTTCGGATTTTGGCCTCTGCACGGGGCTGAAGAAGGCCCATAGAACCGAGTTTTACAGGAACCTGACCCACAATCCCCCCAGTGACTTTTCGTTCCAGAACATGAACTCCAAGAGGAAGGCGGAGACGTGGAAGAAAAACCGCCGACAGCTGGCCTACTCCACTGTTGGGACCCCCGATTACATCGCTCCGGAGGTCTTTATGCAGACGGGCTACAACAAGCTCTGTGATTGGTGGTCGCTGGGGGTCATTATGTACGAGATGTTAATCGGGTACCCCCCATTCTGCTCAGAGACCCCCCAAGAAACGTACAGGAAAGTGATGAACTGGAAGGAGACGTTGGTCTTTCCTCCCGAGGTGCCGACGTCGGAGAAATCCAAGGATCTGATTCTCAGGTTTTGCGCGGACTCGGAAAACCGCGTTGGGTCTAACGGTGTCGAGGAAATTAAGAGCCACCCCTTTTTTGAAGGCGTCGATTGGGGCCACATCAGGGAGAGGCCGGCGGCGATTCCTATTGAAATAAAGAGCATCGATGACACCTCCAATTTCGACGAGTTCCCGGAGTCGGACATATTGCAGCCAGTGTTGAACCCGCCGGAGCCCGACTACAAGTCCAAAGATTGGGTCTTCCTCAATTACACGTACAAGAGGTTCGAAGGCCTGACGCAGCGGGGCTCCATCCCTTCCTACATGAAATCCGGGAAGCTATGA
Full Trace Sequence: gtgagaccggagccgggagcggcgtgtgctgggcacccactaacaggcaccgttactatggcaatgacagcgacgaacccgacgtcttgtccaatgagcagccacacccgggagcgggtcaccgtggccaaactcactctggagactttctatagcaacctgatcctgcagcacgaggagcgagagacccggcagaagaagctggaggtcgccatggaagaggagggcttaggagacgacgagaaaaaaatgcgccggtcgcaacacgcccggaaggaaactgagttcctgcgcctgaagaggacccggctgggcctggaagactttgagtccttgaaagtcatcggccgaggagccttcggagaggtccgccttgttcagaagaaggacaccgggcacatctatgccatgaagatcctacgcaaggctgacatgctggagaaagaacaggtagcgcatatccgggcggagcgggacatcctggtggaagcggatggggcctgggtggtgaagatgttctacagcttccaggataagaggaacctctatctgatcatggagtttctgcccggaggggacatgatgactttgctgatgaagaaggacacgctgacggaggaggcgacgcagttttatatcgccgagactgtcctggctatcgatgccattcaccagctcgggttcatccacagggatatcaagccggacaatctgctattggatgcaaagggtcacgtcaagctttcggattttggcctctgcacggggctgaagaaggcccatagaaccgagttttacaggaacctgacccacaatccccccagtgacttttcgttccagaacatgaactccaagaggaaggcggagacgtggaagaaaaaccgccgacagctggcctactccactgttgggacccccgattacatcgctccggaggtctttatgcagacgggctacaacaagctctgtgattggtggtcgctgggggtcattatgtacgagatgttaatcgggtaccccccattctgctcagagaccccccaagaaacgtacaggaaagtgatgaactggaaggagacgttggtctttcctcccgaggtgccgacgtcggagaaatccaaggatctgattctcaggttttgcgcggactcggaaaaccgcgttgggtctaacggtgtcgaggaaattaagagccaccccttttttgaaggcgtcgattggggccacatcagggagaggccggcggcgattcctattgaaataaagagcatcgatgacacctccaatttcgacgagttcccggagtcggacatattgcagccagtgttgaacccgccggagcccgactacaagtccaaagattgggtcttcctcaattacacgtacaagaggttcgaaggcctgacgcagcggggctccatcccttcctacatgaaatccgggaagctatgagcagcgtcgcccccccaccctgaaacagttactcaggtatccgcagagaacacctctagactgggtgttcccataaacctgtccccacccccggaggaaattcagcaggactaggatttcgcccgacgacagctggctgcgccggcgacttaatccctccccctttttattttggagggaaaaaaactttttattttgattctgcccaaaggtactggaatgtgtgcggctgtctctccggctgtctctctggctgtctctctgtgagccctacaggtcaattgtatgtactggcaccgagccattgtgttataatgggccgccatcactgttatatggccagtaggttaatgtggcctttaaacggtcactattgggcgcccggaggaaacgtactgggttccattgttactttatccgtgtaaatgtctgattttatccttatttattccgcactgccccaatcatcgttcattaaatgtgtcctagcggctgattggcccactagcgactgtttggcataagcccctccctgtgtagcatcaataattaataggcaccacacaggggggggtcaatatagtatcacatgaccttgccgagaagtcgatgattttagctttattaaagggaaagtaaggggtaaaagcatttccatttagggaatcattccaaattttttattaatgttgcaaatgtcttgactctataacactaggtgataagggcgatacagcgcgactatgaaaccgcatgtaatctgcgcttaaagggaaaatataccatatttttgagttttccatatacagttaccctaggatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagagcattccttctctgtatatttgtatttatacatatgggtaggaggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagagcattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagagcattccttctctgtatatttgtatttatacatatgggtagggggtaccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtaggaggtgccatagtgtttcccttagacagtacaatatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtaccgtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccctctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttcccttagacagtacagtatgggggtacagcttattgtgtgcccagaacattccttctctgtatatttgtatttatacatatgggtagggggtgccatagtgtttccctcaggcagtacaggggcattattatggtatatgttccatttaagcgcctgatggcggcgagtcacgttcctttaattcagcttcctgccccagaagagggggcagaagaggaaataatacatgagggcaggggcaatattaagctgtaaggggagttacagttaatagatgtgattgtgttaatagactgtatctgattaattagcttatatatataatgagcaatgtaatataataaataaatctgaccccttagacagatttatcctttcacttttccaaagggctttctgacctgccaaccaggctgctgctgctcagcgattggcaggcactgcagggggggggggggtgttgtttattctattgtggacagtaggtttgctcctatcttcaagggcaagtaacgccaaataggaaaagaaattattgagatctgactgacctgttatttctgttcatctttcagtctctctctcaaagcaatgcatggttgctagggtaaagcagaccctagcaactggatagctgcaaaacaaaaggctaaatcaataaaaacataatactacaccccctgtagcctttgtgcactgagattgcttctgaaccccccaacccagagatttaacccccacctgcctgcattgcattctgggagaatgagaccccagtgcaactctataagactgattcataaaatgacgtctcgcctgaaaggctctttccttcatctcatcctcctcctcctcctctcattatattggggcgcatgtggttttttaaatttttttacatttttttgattgtttgggatctgttgtgtgaattgctggcgccgcgactgtcgctttgtacaaatgtctggcttcaataaaatcactgttaccgacgtgtaaaaaaaaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAMTATNPTSCPMSSHTRERVTVAKLTLETFYSNLILQHEERETRQKKLEVAMEEEGLGDDEKKMRRSQHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEATQFYIAETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPTSEKSKDLILRFCADSENRVGSNGVEEIKSHPFFEGVDWGHIRERPAAIPIEIKSIDDTSNFDEFPESDILQPVLNPPEPDYKSKDWVFLNYTYKRFEGLTQRGSIPSYMKSGKL
Donor tissue: gastrula