ORFeome > sui1-rs1 – XORFeome 2.0

sui1-rs1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis suppressor of initiator codon mutations, related sequence 1 (S. cerevisiae), mRNA (cDNA clone MGC:75713 IMAGE:5380753), complete cds
Gene Symbol: sui1-rs1
Gene ID: 394611
ORF gb_acc: MG132967
ORF ID: 10343

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061273

Library Location

Plate ID: GDExt11004
Well Location: B04

EST Sequences

Clone: MGC:75713 IMAGE:5380753
Trimmed Sequence: ATGTCCTCTATCCAGAACCTCAACTCTTTCGACCCCTTTGCTGATGCAACTAAGGGTGACGACTTACTCCCGGCAGGGACTGAGGATTATATCCATATAAGAATCCAGCAACGTAACGGCAGGAAGACATTAACAACTGTCCAGGGAATTGCAGATGATTACGACAAAAAGAAGCTTGTAAAAGCTTTCAAGAAGAAATTTGCTTGTAATGGTACTGTGATTGAACATCCTGAGTACGGAGAAGTCATTCAGCTTCAGGGGGATCAACGAAAAAATATCTGCCAGTTTCTTATGGAGATTGGCATTGTCAAGGAAGAACAATTAAAGGTTCATGGTTTCTGA
Full Trace Sequence: caagtgacgcctaagctgtgcttaagcttgtggggctgttctatcactaaaccagcacacattagctgccttgtagtccattgtgagacagcgcgatagagcagctttgcctccttgcctagaaaccagcgcctgacgaacatcgccgtagagtcccacagctttactgtcttctgctccgggccagcgccagccttttcctctgcacaccgtgctcgtaataatatcgcatgtcctctatccagaacctcaactctttcgacccctttgctgatgcaactaagggtgacgacttactcccggcagggactgaggattatatccatataagaatccagcaacgtaacggcaggaagacattaacaactgtccagggaattgcagatgattacgacaaaaagaagcttgtaaaagctttcaagaagaaatttgcttgtaatggtactgtgattgaacatcctgagtacggagaagtcattcagcttcagggggatcaacgaaaaaatatctgccagtttcttatggagattggcattgtcaaggaagaacaattaaaggttcatggtttctgagatgtggattacataagattcttgcgacttgccaatcttggctattttgtgaaccatgcatatttgcagtagaaggacttttaacatgtctgagcattcaaaactaggtccttttttgcatgactaccggaaaagtgtaatgattaggctagtaacacataaaaaaatagctgtaagatggtaaaagaacagtgtgttttaccacatttccaatggaaatgttttagtgctggtgtcatttttttgttttttttttttctcccttccctccccttgacttgatttaatgtctttgttgtattaaaaccatatgttgctgcctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSSIQNLNSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLMEIGIVKEEQLKVHGF
Donor tissue: tadpole