ORFeome > surf4 – XORFeome 2.0

surf4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis surfeit gene 4, mRNA (cDNA clone MGC:76061 IMAGE:5307528), complete cds
Gene Symbol: surf4
Gene ID: 395004
ORF gb_acc: MG132748
ORF ID: 10051

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064189

Library Location

Plate ID: GDExt11001
Well Location: B07

EST Sequences

Clone: MGC:76061 IMAGE:5307528
Trimmed Sequence: ATGGGCAGCACCGACATGATGGGAACCGCCGAGGACTTCGCGGATCAGTTTTTACGAGTCACTAAACAGTACCTCCCACACGTGGCCCGACTGTGTCTCATCAGCACCTTCCTGGAGGATGGGATCCGAATGTGGTTCCAGTGGAGCGAGCAGAGAGATTATATTGAGGCCACGTGGAGCTGTGGCTACTTTCTAGCAGCACTCTTTGTCCTTATCAACTTGCTGGGGCAGCTAGGTTGCTGCATCTTGGTGCTTAGTAGAAACTTTGTACAATATGCCTGTTTTGGGTTGTTTGGAATCATAGCAATGCAGACTATTGGATACAGCATCCTGTGGGACCTGAAATTCTTAATGAGGAATCTCGCTCTCGGGGGCGGGGTGTTGCTGCTTCTCGCCGAGTCCAGGTCGGAAGGGAAAAGCATGTTTGCCGGGGTCCCCACCATGGGGGAGAGCTCGCCGAAGCAGTACATGCAGCTGGGGGGCCGCGTCCTCCTCGTCCTCATGTTCATGACCCTCCTTCATTTCGACGCCAGCTTCTTCTCGATCCTGCAGAACTTCGTGGGCACGGCTCTGATCATCTTGGTGGCCATCGGCTTCAAAACCAAGTTGGCGGCTCTGACCCTGGTCGTCTGGCTCTTCGCCATGAACGTCTACTTCAACGCCTTCTGGACCATCCCGGCCTACAAGCCCATGCACGACTTCCTCAAGTACGACTTCTTCCAGACCATGTCTGTCATCGGAGGACTCCTATTGGTCGTGGCTTTGGGGCCCGGTGGGGTCTCCATGGACGAGAAGAAGAAGGAGTGGTAA
Full Trace Sequence: gcaccgcgcaccatgggcagcaccgacatgatgggaaccgccgaggacttcgcggatcagtttttacgagtcactaaacagtacctcccacacgtggcccgactgtgtctcatcagcaccttcctggaggatgggatccgaatgtggttccagtggagcgagcagagagattatattgaggccacgtggagctgtggctactttctagcagcactctttgtccttatcaacttgctggggcagctaggttgctgcatcttggtgcttagtagaaactttgtacaatatgcctgttttgggttgtttggaatcatagcaatgcagactattggatacagcatcctgtgggacctgaaattcttaatgaggaatctcgctctcgggggcggggtgttgctgcttctcgccgagtccaggtcggaagggaaaagcatgtttgccggggtccccaccatgggggagagctcgccgaagcagtacatgcagctggggggccgcgtcctcctcgtcctcatgttcatgaccctccttcatttcgacgccagcttcttctcgatcctgcagaacttcgtgggcacggctctgatcatcttggtggccatcggcttcaaaaccaagttggcggctctgaccctggtcgtctggctcttcgccatgaacgtctacttcaacgccttctggaccatcccggcctacaagcccatgcacgacttcctcaagtacgacttcttccagaccatgtctgtcatcggaggactcctattggtcgtggctttggggcccggtggggtctccatggacgagaagaagaaggagtggtaacgtcccaccgagcccattgctgcctggaaacatccggtgaaacatcttcttctctgcctcctcttcctctcgtgccgccatcattgattcccaccgagcgtcctgctgacagtatccgaccccccaccgatgctcgtcggccattacagcgagtcggttccactaaggactacaacttatgggccggcccttggtcggcggcgtcccttccggatggtactgggattgtttccgtgatacttagtattagtcgtacaaattgcagtaaaaaccgatgccgctgggatgttctgagccatcgttattgtgtatttgggtccggaggtggatgctccctaccgatatatgttgcgcaggtccgtagatctttctgaaccaccccccctggagtctgtgattgtcactcaagcagaaaatgatggtcccccagtgtcagggctggccaactcaaggcccacggggggctgctggtccgccaagagatttttatagcccccgagatttgcatcaaccccttttaaaggagaaggaaaggtaaaaatcggacttcctgctcttagaaaatccctttccatcagagttccccttcccctctccatcagagttccccttcccctctccatcagcgttccccttcccctctccatcagagttccccttcccctctccatcagagttccccttcccctctccatcagagttccccttcccctctccatcagcgttccccttcccctctccatcagcgttccccttcccctctccatcagagttccccttcccctctccatcagcgttccccttcccctctccatctccctgaaaggactctggggcagaaagggagaactgggttccctaccccaacaagtctagccttgacggagccttctgtgtggacattccaatgtggaaatacattttcctgttatcacctggattccaagtcatttcatggaagatgggactgctcgactgtccttatacagacttttttttaaagagtgtgagaagaaaccctgctgggacttggcaaattcttatgttttatccactgtacaaaagattgagtttttttttcttattaattcctctagtattttgctcaaagtgcagaatgttaatggtttgtgcttcagcagcttgtcttgttcagattaaagaacctcatctggttacctgtttttagtaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGSTDMMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIEATWSCGYFLAALFVLINLLGQLGCCILVLSRNFVQYACFGLFGIIAMQTIGYSILWDLKFLMRNLALGGGVLLLLAESRSEGKSMFAGVPTMGESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSILQNFVGTALIILVAIGFKTKLAALTLVVWLFAMNVYFNAFWTIPAYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW
Donor tissue: gastrula