ORFeome > sypl1 – XORFeome 2.0

sypl1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis synaptophysin-like 1, mRNA (cDNA clone MGC:76143 IMAGE:5335210), complete cds
Gene Symbol: sypl1
Gene ID: 394679
ORF gb_acc: MG132725
ORF ID: 10022

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062512

Library Location

Plate ID: GDExt11001
Well Location: C02

EST Sequences

Clone: MGC:76143 IMAGE:5335210
Trimmed Sequence: ATGGTCGGCTGGCAGCTGAACCTTGGCCCGCTAAAGGAGCCCCTGGGCTTTATCAAATTATTGGAATGGTTTGCTTCAATCTTTTCATTTGCCACTTGTGGTGGTTACAGTGGCAAAACTGAATTAATAGTAAGCTGTTTAGGATCTTCAGAAAATAAAACTGCTACCGCTTCATTTATGTATCCGTTTCGATTAAATGTTCAAGTGTTTGAAGGGATACCCAAATTATTCTGTAATCAAACATGGAAAGACTTTCACCTTACAGGAGATTTTTCTGCCCCAGCCCAGTTCTACGTTTCTATTGGAGTCTTTGCCTTTCTTTACTGCATGGCTGCTCTTGTGTTTTATCTAGGTTTTATGCAGTTGTATCGGGACTCTCAAAAATTCCCATTATGTGACTTCTTCATTACGGTCTTCTTTGCTTTAATGTGGCTGGTTAGTTCCTCAGCTTGGGCTAAAGGTTTGACAGATATAAAAGCCTCCACCAGCCCTCAAGGTATTGCACAGTATACCTGCCCGACTGGTTACAAATGTCTGCCTGGGCAAGAGTCACACATGGGAAGTCTGAACATCTCTGTGGCGTTTGGATTTTTGAATCTGATACTGTGGGCAGGAAATGCTTGGTTTGTATACAAGGAGACAAGCCTACATACTCCTCCACAACAACCAAACCCGGAGCAAGCACCTGGAAATGTTTCTCCATGA
Full Trace Sequence: gagatacattgcgtggcctgggctgatagctgtagtcgtgtcttggcctatcgtgttcgtcttcatcctgtttgtgtctccttgcagaaaatggtcggctggcagctgaaccttggcccgctaaaggagcccctgggctttatcaaattattggaatggtttgcttcaatcttttcatttgccacttgtggtggttacagtggcaaaactgaattaatagtaagctgtttaggatcttcagaaaataaaactgctaccgcttcatttatgtatccgtttcgattaaatgttcaagtgtttgaagggatacccaaattattctgtaatcaaacatggaaagactttcaccttacaggagatttttctgccccagcccagttctacgtttctattggagtctttgcctttctttactgcatggctgctcttgtgttttatctaggttttatgcagttgtatcgggactctcaaaaattcccattatgtgacttcttcattacggtcttctttgctttaatgtggctggttagttcctcagcttgggctaaaggtttgacagatataaaagcctccaccagccctcaaggtattgcacagtatacctgcccgactggttacaaatgtctgcctgggcaagagtcacacatgggaagtctgaacatctctgtggcgtttggatttttgaatctgatactgtgggcaggaaatgcttggtttgtatacaaggagacaagcctacatactcctccacaacaaccaaacccggagcaagcacctggaaatgtttctccatgaatttaaagataaatcctatagaaatgccaattcacatttaatggcctacaatctggtgttttcaatgccaaggattgcattgtttatgtgttaataaacatgtggatacaaggtattcatgccaggattcctctttctgaaaaacaggcctacgacttatttcaagcaggttttccagttacagaacaatgttttgttgtgaacagtgatgtactgcagtttattggctttaaaacactaaggtttttaggagtgcaaacactgataaatatttcttcaatatgttgttttgaaaaatgacagaatatgaagtactgtactaatttggaatacctattctgatgtaactataaaaattgggatttcctcttaaaccaaaagcttttgtcatataataggcaaactctctgcaatgcttaagtttaatataaaagcttaccagtataaatgcttttttttatattctagatattttgaacatttgtttctcttattttattgcacaaaaccccaagttcgtctcttttacatgtactattttttagagcactgttgaaaatgttaatggaaatagatggttgtgcaggttactgaatatgtacaagcaattacagccctattgtagcttttgccacaagtttgcattctagacacacatttaccctatttcccaatactgtttatatgcctaactgtttttctccatgtatatgaattattgttctgaatcagataaaaaaaaactattctgtacctgctgatgcaatattaaagataagttttggttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVGWQLNLGPLKEPLGFIKLLEWFASIFSFATCGGYSGKTELIVSCLGSSENKTATASFMYPFRLNVQVFEGIPKLFCNQTWKDFHLTGDFSAPAQFYVSIGVFAFLYCMAALVFYLGFMQLYRDSQKFPLCDFFITVFFALMWLVSSSAWAKGLTDIKASTSPQGIAQYTCPTGYKCLPGQESHMGSLNISVAFGFLNLILWAGNAWFVYKETSLHTPPQQPNPEQAPGNVSP
Donor tissue: tailbud