ORFeome > sypl2 – XORFeome 2.0

sypl2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis synaptophysin-like 2, mRNA (cDNA clone MGC:88982 IMAGE:7003818), complete cds
Gene Symbol: sypl2
Gene ID: 448559
ORF gb_acc: MG134024
ORF ID: 11639

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076891

Library Location

Plate ID: GDExt11016
Well Location: E10

EST Sequences

Clone: MGC:88982 IMAGE:7003818
Trimmed Sequence: ATGGACAGAGAGGGGGGCCTTGCAGGACTTGGCAAGAAGAACCCACTGGCTGGTCTACGCTGGAGGAGGTTAGAGGAGCCATTGGGATTCATTAAGTTACTGGAATGGCTGTTTGCTATATTTGCCTTTGGATGTTGTGGGTCATACAGTGGAGAGACAGCAGCAACTGTCATGTGCAAGACAGAGACGGACTCAGACACAGAAATAAAGCTCATCTCAGTTCCCTTTGCATACCCATTCAGGCTGTATCGCCAGCGCTATGAGATGCCAGCTTGTGAAGATATAGAAAGGCGTATTCTCCACTTGACAGGGGATTTCTCAGCCCCCGCAGAGTTCTTTGTTACCATGGGAGTCTTTGCATTCCTATACTCTATGTTTGCACTGGTCGTCTATCTGCGCTTCCACGAAGAATACACCAAAATCCGCCGAGTGCCAATTGTGGATTTGTGCGTGACTGGTGCCTTTGCCTTTTTGTGGCTTGTGGCAGCTTCAGCTTGGGGGAAAGGACTGATGGATGTGAAGGTGGCCACTCAACCTTCCAACCTTGTCTCTTCAATGCCTCTGTGCCAAATGGAAAAAGCAACATGCAATGCTGGCTCTCAACCATATTTTGCACTTGCTAACATTTCTGTGCTCTTTGGCTTTCTGAATTTCCTTATCTGGGCTGCCAATGTATGGTTTGTGTTTAAAGAGACCACATTGAGTAATAAACCTGCCTCCAAAGAGGAATCTGCAGAGCGTGGAGAGGTTGAAGACCACCAGTGA
Full Trace Sequence: gtaacttaattaagttgcggaaatatcagtaatcaaactgatacagatttttagtcatatttacagaatatccagaaacaatattgtgtcagtggtacaaatttacagaaagcctgtctgcataaaacaaatactatatacatttaatgaactagatttatagattgtaaagctgtaagagagaggaaacggtaggtacagaaaaaaagtaacaggtttacagaagctggtcatcaggaggaacagacacactcccttcacttggatacttgagcccttctgttcagacgactgagttccagccacttacccttggacacccttaaataaggaccatgtcaacagcagtttcctcctcaacgatggacagagaggggggccttgcaggacttggcaagaagaacccactggctggtctacgctggaggaggttagaggagccattgggattcattaagttactggaatggctgtttgctatatttgcctttggatgttgtgggtcatacagtggagagacagcagcaactgtcatgtgcaagacagagacggactcagacacagaaataaagctcatctcagttccctttgcatacccattcaggctgtatcgccagcgctatgagatgccagcttgtgaagatatagaaaggcgtattctccacttgacaggggatttctcagcccccgcagagttctttgttaccatgggagtctttgcattcctatactctatgtttgcactggtcgtctatctgcgcttccacgaagaatacaccaaaatccgccgagtgccaattgtggatttgtgcgtgactggtgcctttgcctttttgtggcttgtggcagcttcagcttgggggaaaggactgatggatgtgaaggtggccactcaaccttccaaccttgtctcttcaatgcctctgtgccaaatggaaaaagcaacatgcaatgctggctctcaaccatattttgcacttgctaacatttctgtgctctttggctttctgaatttccttatctgggctgccaatgtatggtttgtgtttaaagagaccacattgagtaataaacctgcctccaaagaggaatctgcagagcgtggagaggttgaagaccaccagtgatacctggcaaacaaattcctgggtttccaacatcaactcttcctcctgaaattctagaaatgagccctctcctttaccaggcttcaaattatcattatgatcttttattttttgccctaacactgtccactctttcagtgaatatgagtaatattccaaaaacataccagtatacagaggtgcttattaaaactgcttaatgtagggtttatttgaatcatatttaatacagcccagcatatagcgtattttatgtacgagtaacccaatttgtacctaaccatagacacaaataaaaaagcagggttgagctttttataatgctgtttataacagtatttatttttaaatatgtgccctactgtataggacagtactgatccataatatcctttcttttggaattgcctcctgtcctgtaaccttaataacctttctcacctgtccacagtaagatgacccatctatctccagtgtctctggtgctatttattaaataaaaataaatactctacaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDREGGLAGLGKKNPLAGLRWRRLEEPLGFIKLLEWLFAIFAFGCCGSYSGETAATVMCKTETDSDTEIKLISVPFAYPFRLYRQRYEMPACEDIERRILHLTGDFSAPAEFFVTMGVFAFLYSMFALVVYLRFHEEYTKIRRVPIVDLCVTGAFAFLWLVAASAWGKGLMDVKVATQPSNLVSSMPLCQMEKATCNAGSQPYFALANISVLFGFLNFLIWAANVWFVFKETTLSNKPASKEESAERGEVEDHQ
Donor tissue: