ORFeome > tax1bp3 – XORFeome 2.0

tax1bp3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis Tax1 (human T-cell leukemia virus type I) binding protein 3, mRNA (cDNA clone MGC:76248 IMAGE:5378991), complete cds
Gene Symbol: tax1bp3
Gene ID: 394838
ORF gb_acc: MG132845
ORF ID: 10197

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063221

Library Location

Plate ID: GDExt11003
Well Location: C02

EST Sequences

Clone: MGC:76248 IMAGE:5378991
Trimmed Sequence: ATGTCTTACATCCCGGGCCAGCCGGTCACTGCTGTAGTGCAACGGGTTGAAATCTATAAATTGCACCAAGGGGATAATCTGATCCTTGGCTTCAGCATTGGAGGAGGAATCGACCAGGACCCGGCACAAAACCCTTTCTCCGAGGACAAGACAGACAAGGGTATCTATGTGACACGAGTAACAGAGGGAGGCCCTGCGGAGGTGGCTGGACTTCAAATTGGAGACAAAATAATGCAGGTAAATGGATGGGACATGACAATGGTAACGCACGACCAGGCAAGGAAACGCCTCACCAAGAAAAATGAGGAGGTTGTCCGGCTGCTTGTGACCAGAAAATCCTTGCAAGAGGCTGTGAGACAGTCCATGAGACCCTAA
Full Trace Sequence: ccggagtgagctagcagccatgtcttacatcccgggccagccggtcactgctgtagtgcaacgggttgaaatctataaattgcaccaaggggataatctgatccttggcttcagcattggaggaggaatcgaccaggacccggcacaaaaccctttctccgaggacaagacagacaagggtatctatgtgacacgagtaacagagggaggccctgcggaggtggctggacttcaaattggagacaaaataatgcaggtaaatggatgggacatgacaatggtaacgcacgaccaggcaaggaaacgcctcaccaagaaaaatgaggaggttgtccggctgcttgtgaccagaaaatccttgcaagaggctgtgagacagtccatgagaccctaagcatcacattcccgagagtctgaatctcttagctacacaggtgtacttacccggacacatttcagttctgtattacacacaccagcagcacattgcagggctataggttgctggctcctttctgtccctcccaggctactgcttgttccgcaccaaaacaaaccaaaaagaattctaatgtgcctggctcccattggcctaaattctgcccgtctttatccttgcaaatgaaagagcaatttcttactgccccagtagaaaagcacacatctttccactgcaaagataaagcaggtaggtatctcctatgccctagtattgaaatagggaagatcaccaggtggcctctccaatgcgattcccagttcacttttttaatactttcaggtgttaagttgcttctattggagcaaccacaaatatggggactttattttacaaaattcaacatgtaaacagaggtccctgtatcactggtttatacacagatttgtacttgcagagcaaatagtctcttctaggaggggaagtagagtttgtactgagtcatcctcgcctttcagcatttatcacaagggctgccatcagcagtctctgggtacagcctgggtcactgcctctaattaccgtcagggtcaatcagctgaatcaataaatgcttaatctaggcaaaatttgtaggtgtaagcgctcttatcaatttgacttttttcatgatattaccagttactacactgctgatgtgaatgtgtaacaggagtgccccctgtttttgggcccaggtaagggccagacgaatggcaaaagattaatttacagaagcagaaagcctcctgtcgcttctctgctcagttttattcttaccctcttggcacattacaagagacaactggacaagaaccctaccctgagcccaatcaacaggggacactctgatattagcagtgttaaaactgccaatgtcgtcaaatctaaaacaaaatttacctataaattgcaaaagtgctcagaagagcattctggacaattttacattgttccatttagggtatgtgtctctttgaggggcttcaagacctagtgctgtcagaggttactgactttggcgcccaactggccaaggtttaataggagaatccaggaaatagattgcccagggaatatactgctttgttactggtgttactacagcacagacaatcagacaagttcccctgtccccttttatctatatctctagcaattcatatgcagtcccactgccaccagcaactgactggcctgtactaatttatataaatatatatatatgaaaccactccatatagctagtttaactgtcttgtatcatttccagttttaactgtactgtatgtactttgcattacttttctaaatttctgaccaaacgatattcctaggcttgtaataaactgcttttgattgtggcaagacactcctatatgtttatgttcatcagttgagacttctccagtttggaccagaatgagttaatctttcccagaagctgttttgcctgtgtgcattacatcagtaagactggaatcatgattttcctgtacggacgtgactaatgtctgtatttgtctagtaagtcagtggctgcttgagttctggtgtatgacctgcagcatgtttcatttggaccaatgagaattcagaactggagaacgctacgctactggcaggccaagcttttatagaattgtaactgtggctgaagctgtctacccagtcacatggaaacatattaggctgcataatgtgaacaaatcctttgccgtttaagttccacatcctctcatggggccccgcagcagttcttgttttatcacaagttgcagaatgacattgagtgatagtttgtataaagcttttgttagaaacactaaagtgcctcttcctactatcggtgcagggcaggctgtgctacccattgctgccagtcttgctaatgcccacatgtgagtcacaaaacagaaattccagtcctgttggagctcagtaggtgctattgctcatatcctttttatatgggaatatactcttaggagtctgattgtttgatatgacaggcaagggtgtcactattattcttgcttgtgtgctttattccatatgggaccccagtatcacaatttgtaactgaattaaagaggaaaaaatgtttttaaaataatcattcgggttgatggtaaataccccttcatacagcaatataaaaccttattgtttttattgcaaacagtttcattaggtgaaagcagccaatagacgtgcatgtatagattaccaaataaacactagatgttacatttgatattttttcaaaacccctatataggttatagctatttgttttttgggaaaagcatgtctgaattactatatccagcttgaatgggaactgaagctcaccaggagcttttgcctgccggcctactgcagtgtgtagggatgggttccctgtgggaccttggcctttaaagctgcactctagccccaatatgaccaaaggaggaaaatcgtgtaatttaggcttctgagtgctatggacccctgagatccagactgatccctaacaaagtcagcttcagagagagggctgcttaaaccactaagttgcacatttcattaatgttcctgttttgtatgcgttttgcacacgtttgtgttactttcactactcaagctgtaggtagtgtccctgctgctagacgtgcacactaatgtcctacttcatttgaaccagtgctggcccccagccccagattcacttgacttgcatttccaggccactgacagacttagttactattctacataaacctagggcttatctgaccaaacacatggatatggttggacgtttcaggccttcttacctctcgaacaactgcatttactggctaatgttatctgcttgttcacacctagtcactggcttgccctataatccatcaacattggacgggtggtctgtttgcgtattgttcttgttgctaggtctacatgaccctagcaatcagacaggtttgaatgacacatgaaagctttattgagtgacgtgatttaaagtattggtaatcactaatttctatgccagcagataaagtgtgtgagtttttacctgacattacagtagtagattgcagagatctgtgctttcctgtttgctttccctttgaccaatgtgccaaaaagtctttatactttgtaaattactgggaaaagggggggagatttgttattctgcttttctatgtggacacgtttgctgaataaaatctaccttactttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSYIPGQPVTAVVQRVEIYKLHQGDNLILGFSIGGGIDQDPAQNPFSEDKTDKGIYVTRVTEGGPAEVAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKKNEEVVRLLVTRKSLQEAVRQSMRP
Donor tissue: tailbud