ORFeome > tax1bp3 – XORFeome 2.0

tax1bp3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis Tax1 (human T-cell leukemia virus type I) binding protein 3, mRNA (cDNA clone MGC:89968 IMAGE:7025852), complete cds
Gene Symbol: tax1bp3
Gene ID: 394838
ORF gb_acc: MG133080
ORF ID: 10497

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080496

Library Location

Plate ID: GDExt11005
Well Location: A08

EST Sequences

Clone: MGC:89968 IMAGE:7025852
Trimmed Sequence: ATGTCTTACATCCCGGGCCAGCCGGTCACTGCTGTAGTGCAACGGGTTGAAATCTATAAATTGCACCAAGGGGATAATCTGATCCTTGGCTTCAGCATTGGAGGAGGAATCGACCAGGACCCGGCACAAAACCCTTTCTCCGAGGACAAGACAGACAAGGGTATCTATGTGACACGAGTAACAGAGGGAGGCCCTGCGGAGGTGGCTGGACTTCAAATTGGAGACAAAATAATGCAGGTAAATGGATGGGACATGACAATGGTAACGCACGACCAGGCAAGGAAACGCCTCACCAAGAAAAATGAGGAGGTTGTCCGGCTGCTTGTGACCAGAAAATCCTTGCAAGAGGCTGTGAGACAGTCCATGAGACCCTAA
Full Trace Sequence: ctgtgagctagcagccatgtcttacatcccgggccagccggtcactgctgtagtgcaacgggttgaaatctataaattgcaccaaggggataatctgatccttggcttcagcattggaggaggaatcgaccaggacccggcacaaaaccctttctccgaggacaagacagacaagggtatctatgtgacacgagtaacagagggaggccctgcggaggtggctggacttcaaattggagacaaaataatgcaggtaaatggatgggacatgacaatggtaacgcacgaccaggcaaggaaacgcctcaccaagaaaaatgaggaggttgtccggctgcttgtgaccagaaaatccttgcaagaggctgtgagacagtccatgagaccctaagcatcacattcccgagagtctgaatctcttagctacacaggtgtacttacccggacacatttcagttctgtattacacacaccagcagcacattgcagggctataggttgctggctcctttctgtccctcccaggctactgcttgttccgcaccaaaacaaaccaaaaagaattctaatgtgcctggctcccattggcctaaattctgcccgtctttatccttgcaaatgaaagagcaatttcttactgccccggtagaaaagcacacatctttccactgcaaagataaagcaggtaggtatctcctatgccctagtattgaaatagggaagatcaccaggtggcctctccaatgcgattcccagttcacttttttaatactttcaggtgttaagttgcttctattggagcaaccacaaatatggggactttattttacaaaattcaacatgtaaacagaggtccctgtatcactggtttatacacagatttgtacttgcagagcaaatagtctcttctaggaggggaagtagagtttgtactgagtcatcctcgcctttcagcatttatcacaagggctgccatcagcagtctctgggtacagcctgggtcactgcctctaattaccgtcagggtcaatcagctgaatcaataaatgcttaatctaggcagaatttgtaggtgtaagcgctcttatcaatttgacttttttcatgatattaccagttactacactgctgatgtgaatgtgtaacaggagtgccccctgtttttgggcccaggtaagggccagacgaatggcaaaagattaatttacagaagcagaaagcctcctgtcgcttctctgctcagttttattcttaccctcttggcacattacaagagacaactggacaagaaccctaccctgagcccaatcaacaggggacactctgatattagcagtgttaaaactgccaatgtcgtcaaatctaaaacaaaatttacctataaattgcaaaagtgctcagaagagcattctggacaattttacattgttccatttagggtatgtgtctctttgaggggcttcaagacctagtgctgtcagaggttactgactttggcgcccaactggccaaggtttaataggagaatccaggaaatagattgcccagggaatatactgctttgttactggtgttactacagcacagacaatcagacaagttcccctgtccccttttatctatatctctagcaattcatatgcagtcccactgccaccagcaactgactggcctgtactaatttatataaatatatatatatgaaaccactccatatagctagtttaactgtcttgtatcatttccagttttaactgtactgtatgtactttgcattacttttctaaatttctgaccaaacgatattcctaggcttgtaataaactgcttttgattgtggcaaaaaaaaaaaaaaaa
Translation: MSYIPGQPVTAVVQRVEIYKLHQGDNLILGFSIGGGIDQDPAQNPFSEDKTDKGIYVTRVTEGGPAEVAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKKNEEVVRLLVTRKSLQEAVRQSMRP
Donor tissue: