ORFeome > thedc1 – XORFeome 2.0

thedc1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis thioesterase domain containing 1, mRNA (cDNA clone MGC:69559 IMAGE:5379013), complete cds
Gene Symbol: thedc1
Gene ID: 407865
ORF gb_acc: MG133337
ORF ID: 10837

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067998

Library Location

Plate ID: GDExt11008
Well Location: H05

EST Sequences

Clone: MGC:69559 IMAGE:5379013
Trimmed Sequence: ATGGACAAACTCATCACCTGCCTCTATCGACGACCCAGCGCAACAACAAGATTAATATGCTTCCCATGGGCTGGAGGGGGATCAATCTATTTTGCACAATGGGCCAGGCTGTTTGATGACTCAATAGAAGTGTACTCTGTAAGGCTTCCTGGAAGAGAATCACGTTCCCAAGAAGCTTTTGCTCAGACGATGGACCAAATAGTCAATGAAGTAACAAATACTTTGCTGCCAAAGCTACATGAAAAAGAATTTGCATTTTTTGGCCACAGCTTTGGCGCTTTCACTAGTTTTGCTACAGCAGTGACGCTTAAGCAGAAGCACAATCTGGAGCCTGTCCATCTTTTTGTGTCTGGAGTATCAGCCCCACATTCCGAATCTAGGTCTTCTGTGGTAAAAAAATCTGAGCTGAGCGATGAGGAGTTTTTAAGGTATATGTCCGAAGCAGGAGGAACGCCCAAGGAAATCTTGCAGAACAAGGATGCCCTGCAGATGTTTATTCCCCCACTCAGAGCTGATCTCAGGGTTGTTGAGAACTTCATCTATGACAAGCCAGCAAGCCCTGTCCTTTCCTGTGGACTTACCTGTTTTGATGGCACAGAGGACAATCCACATGATTTAGATGCATGGAAAGACCTTACAAGTGGAGATTTCAACATACACAAATTACCCGGAGGCCATTTCTACTTAAAGGATCCTGCAAATGAAAAGCAGCTTGTGAAGTATATAACAAAGTATTTAGAAACTGCTGAAATGGATTATTTGTGA
Full Trace Sequence: ctagcagtatgtggggcaatcctcttcatggcaagtggaaatgacgcaacagtgctgagagcagtgcaggatggacaaactcatcacctgcctctatcgacgacccagcgcaacaacaagattaatatgcttcccatgggctggagggggatcaatctattttgcacaatgggccaggctgtttgatgactcaatagaagtgtactctgtaaggcttcctggaagagaatcacgttcccaagaagcttttgctcagacgatggaccaaatagtcaatgaagtaacaaatactttgctgccaaagctacatgaaaaagaatttgcattttttggccacagctttggcgctttcactagttttgctacagcagtgacgcttaagcagaagcacaatctggagcctgtccatctttttgtgtctggagtatcagccccacattccgaatctaggtcttctgtggtaaaaaaatctgagctgagcgatgaggagtttttaaggtatatgtccgaagcaggaggaacgcccaaggaaatcttgcagaacaaggatgccctgcagatgtttattcccccactcagagctgatctcagggttgttgagaacttcatctatgacaagccagcaagccctgtcctttcctgtggacttacctgttttgatggcacagaggacaatccacatgatttagatgcatggaaagaccttacaagtggagatttcaacatacacaaattacccggaggccatttctacttaaaggatcctgcaaatgaaaagcagcttgtgaagtatataacaaagtatttagaaactgctgaaatggattatttgtgaattttgctgacacagagccattttcagcattcatattacgaaggaaagaagatactaaatgtttagtgttatttcaacagctttctcttacttgcaagcgtatttataaatgtcttcattatctgcaatataaacatattttattaaacgaattttcatttttgctgtattgtaagattaaaaggagaagattggcattaatataatcttttggtgttgtgtatactgtaaggggaatatacagtttacaatgctgtgaatatacagcaaggtacatggattaataagtgagcgttgagttggccatgcacctgaagatctgctcattggagaggtgccttgatttggccaccgatatgatgccatttcctaacccaagtgacagttatatgagcagtatttcagatacgattaactcccggaaatagcagtcccctcaatttatttagctaaaagtgctctgaaacataaggcaaaatggcatcttagatagaacggttctaaattaatagagactaggaaattatttattttttttttttaacaattcttttattgagtttgaatgtacatattttgcagtattttacaatccaatgacttttgtttattgtacaataggtaaataaaaccaaattaacaatttaacagtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDKLITCLYRRPSATTRLICFPWAGGGSIYFAQWARLFDDSIEVYSVRLPGRESRSQEAFAQTMDQIVNEVTNTLLPKLHEKEFAFFGHSFGAFTSFATAVTLKQKHNLEPVHLFVSGVSAPHSESRSSVVKKSELSDEEFLRYMSEAGGTPKEILQNKDALQMFIPPLRADLRVVENFIYDKPASPVLSCGLTCFDGTEDNPHDLDAWKDLTSGDFNIHKLPGGHFYLKDPANEKQLVKYITKYLETAEMDYL
Donor tissue: tailbud